KEGG   Trichormus variabilis: Ava_1783Help
Entry
Ava_1783          CDS       T00277                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ava  Trichormus variabilis
Pathway
ava00020  Citrate cycle (TCA cycle)
ava00640  Propanoate metabolism
ava00660  C5-Branched dibasic acid metabolism
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
ava01120  Microbial metabolism in diverse environments
ava01130  Biosynthesis of antibiotics
ava01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ava_1783
   00640 Propanoate metabolism
    Ava_1783
   00660 C5-Branched dibasic acid metabolism
    Ava_1783
Enzymes [BR:ava01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ava_1783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA
Motif
Other DBs
NCBI-ProteinID: ABA21405
JGI: Ava1783
CyanoBase: Ava_1783
CYORF: Ava_1783
UniProt: Q3MC81
Position
2225359..2226585
Genome map
AA seq 408 aa AA seqDB search
MDLLEYQVKEWFGEIGIPVLPSQRIDHPTDLKRLKIRYPIVLKSQVHAGEREKVGGVRMV
ETTIDAIAAAQTIFNLSIWGELPEVLLAESKYNSHQEFYLAVVLDTAVCRPVLLGSTEAD
IDLELADQKMQYVVVEQEFSPFYARRLALKMGLQGTLMQSVSTVLEKMYQLFVQKDLDLV
EINPLGVNLAGEVMALNGKVGVNERAIGRHPEIAAMAAKIIPRHYDKSFSNGRDWNNLEK
QRRIGILGNGTGSILATYDLVASGGGKPGICLNLRHAAITDLSPTKFGDRLTKGLNTLAA
DKNTQVILINLLGSIPQPEEAAQAIAQFIQQNKGEYPPSIAKSNGKNLSQHQSPQLVIRL
AGSELNAAKEVLAALQTHEEGLILVEDLDEAVATAVRLTKSHAYKKVS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggatttattggagtaccaagttaaagaatggtttggagaaataggcattcctgtattg
ccatcccaaagaattgaccatcctacagatttaaaacgcttaaaaattcgctaccccatt
gtgctgaaatcacaggttcatgcgggagagagggaaaaagtcggtggtgtaagaatggta
gaaaccacaatcgacgcgatcgcagcagctcaaacgatctttaatctatcgatatggggt
gaattaccagaagttctgttagcagaatctaagtataattctcaccaagaattttatttg
gctgtagttttagatactgctgtttgtcgtccagtacttttaggttccacagaagcggat
attgatttagagttagctgatcaaaaaatgcagtatgtggtggtcgagcaagaattttcg
cctttttatgctcgtaggttggctttaaagatgggtctgcaaggtacgctgatgcagtcg
gtcagcacagtgttagaaaaaatgtaccagttattcgtgcagaaagacctggatttagta
gaaataaatcctctgggtgtcaaccttgctggtgaggtgatggctcttaatggtaaagtt
ggagtcaacgaaagggctattgggcgacatccagaaattgccgcaatggcagccaaaata
atccctcgtcattatgataaaagttttagtaatgggcgtgactggaataatttagaaaaa
caacgcagaattggtattttaggtaatggtactggttctatcttggcgacctatgattta
gttgctagtgggggtggtaaaccaggaatttgtctgaatctacgccacgcagcaattact
gatctgtcaccaactaaatttggcgatcgcctcaccaaaggtctaaataccttggctgct
gacaaaaatactcaagtgatcttgattaacttgctaggaagtattcctcaaccagaagaa
gcagcacaagcgatcgctcaattcatacaacagaacaaaggtgaatatccaccatcaatt
gccaagtctaatggtaaaaaccttagtcaacatcagtcaccacaattagtcattcgtcta
gccggttcggagttgaatgcagctaaggaggttttagcggctttacaaacccatgaagag
ggactgatattagtagaagacttagacgaagcagttgcaaccgcagttcgtttgactaaa
tcacacgcgtataaaaaagtttcctga

DBGET integrated database retrieval system