KEGG   Anabaena variabilis: Ava_1852Help
Entry
Ava_1852          CDS       T00277                                 

Definition
(GenBank) Photosystem II protein PsbJ
  KO
K02711  
photosystem II PsbJ protein
Organism
ava  Anabaena variabilis
Pathway
Photosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    Ava_1852
Photosynthesis proteins [BR:ava00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    Ava_1852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2309840..2309986)
Genome map
AA seq 48 aa AA seqDB search
MLLREEKAVSAGSGRIPLWVVATIAGLGVITVVGIFFYGAYAGLGSSI
NT seq 147 nt NT seq  +upstreamnt  +downstreamnt
ttgttgttaagggaggagaaagctgtgtctgctggaagtgggagaattcccctgtgggtc
gtcgctacgatcgcaggtttaggtgtaattacagttgtaggtatcttcttctatggagcc
tacgctggacttggttcttcaatataa

DBGET integrated database retrieval system