KEGG   Anabaena variabilis: Ava_1911Help
Entry
Ava_1911          CDS       T00277                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ava  Anabaena variabilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ava_1911
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ava_1911
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ava_1911
Enzymes [BR:ava01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ava_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2373469..2374710
Genome map
AA seq 413 aa AA seqDB search
MTTTPLSPSTPSNAQVPDIQGRFGRFGGKYVPETLMPALAELETAYQKYRHDPGFQAELQ
QLLRDYVGRATPLYFAERLTAHYARPDGTGAQIYLKREDLNHTGAHKINNALGQVLLAKR
MGKQRIIAETGAGQHGVATATVCARFGLECVIYMGVHDMERQALNVFRMRLMGAEVRPVE
AGTGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHAVIGQETRAQALEKW
GGLPDILLACVGGGSNAMGLFYEFVNESSIRLIGVEAAGEGVNTEKHAATLTKGRVGVLH
GAMSYLLQDEDGQVIEAHSISAGLDYPGVGPEHSYLKDVGRAEYYSVTDEQALAAFQRLS
RLEGIIPALETAHAIAYLETLCPQLDGSPRIIINCSGRGDKDVQTVAKFLIPQ
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgactaccactcccctttctccaagtaccccctcaaatgctcaggttcccgatatccaa
ggacgctttggacgctttggcggtaagtatgtgccggaaaccttgatgccggctttggct
gaattagaaacagcttatcaaaaataccgccatgaccctggttttcaagcagaactgcaa
caattattacgggactacgtaggacgtgcgacaccgttgtattttgcagaacgcctcact
gcccattatgcccgaccagatggtacaggagcgcaaatttacttaaaacgcgaagattta
aatcatacaggtgctcataaaattaataacgcccttggtcaagtattattagccaagcgc
atgggtaagcagcgcattattgccgaaaccggtgctggacaacatggtgtagcaacggct
acagtttgcgctcggtttgggttggaatgtgtgatttatatgggtgttcacgatatggaa
cgccaagctttgaatgtgtttagaatgcggctgatgggggctgaagttcgtccagtagag
gctgggactggaactctcaaggacgctacatctgaggcaattcgggattgggtgacgaat
gtggaaactactcactacattttgggttccgtcgccgggcctcatccttacccaatgatg
gtacgggattttcatgcagtcattgggcaagaaactcgcgctcaagctttggaaaaatgg
ggtggtttacccgatattctcttggcttgtgtgggtggcgggtctaatgcgatgggctta
ttttacgagtttgtgaatgagtcatccattaggttaattggagtagaagcagctggggaa
ggtgtcaatacagaaaagcacgctgccaccttgacaaaagggcgcgttggtgtattacac
ggggcgatgagttatctgctgcaagatgaggatggccaggtaattgaagcgcactcgatt
agcgcggggttagattaccctggtgtggggccagaacacagctatttgaaggatgttggt
cgtgcagaatattacagtgtgacggatgagcaagctttggctgcgttccagcgattatcc
cgcttggaaggaattatcccagccctggaaacagcccatgcgatcgcctacttagaaacc
ctctgtcctcaacttgacggtagcccccgcattattatcaactgctctggacgcggtgat
aaagatgtccaaactgtagctaagtttttaatcccacaataa

DBGET integrated database retrieval system