KEGG   Anabaena variabilis: Ava_1940Help
Entry
Ava_1940          CDS       T00277                                 

Definition
hydrogenobyrinic acid a,c-diamide cobaltochelatase (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
ava  Anabaena variabilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ava00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2409009..2412671)
Genome map
AA seq 1220 aa AA seqDB search
MKRIVLIAGFESFNADLYRKAAFLANSRCADLDIRVFSDRDITSKRLEVEAALQGADVFF
GSLLFDYDQVVWLRDRVSQIPIRLVFESALELMSLTKLGAFAIGDKPKGMPKPVKFILDK
FSNGREEDKLAGYISFLKIGPKLLKFVPVQKVQDLRNWLIIYGYWNAGGTENVAALFWTL
AEKYLDLKIGDIPPPIETPNIGLLHPDYPGFFASPREYLAWYQTHPRNVATNPVVGILLY
RKHVITKQPYIPQLIRRFEDAGFIPLPIFINGVEGHVAVRDWMTTDYEFQQRQIGNIATP
SLSPEAVKVDAIVSTIGFPLVGGPAGSMEAGRQVEVAKRILTAKNVPYIVAAPLLIQDIH
SWTRQGVGGLQSVVLYALPELDGAIDTIPLGGLVGEDIYLVPERVQRLIGRVKSWIALRQ
TPPAERKIAIILYGFPPGYGATGTAALLNVPRSLIKLLHALKDQGYNVGDIPEDGEELIR
LVKETDEEMERWEKNKPFPSSANTVNSRKLEKWLGYLRTSRIEKQWKSLTGSGIKTYGDE
LHVGGVQLGNVWIGVQPPLGIQGDPMRLMFERDLTPHPQYAAFYKWLQNELQADAVVHFG
MHGTVEWLPGSPLGNTGYSWSDILLGDLPNLYIYAANNPSESILAKRRGYGVLISHNVPP
YGRAGLYKELITLRDLIAEYREDPQKNYVLKEGICKKIVDTGLDTDCPFEDAKRLGISFT
PENIRMFSAHAFDDYLVKLYEYLQVLETRLFSSGLHTLGEAPNQEELASYLNAYFGEEQS
KDPEIEQQITDLLMQTTDELTNLLRGLNGEYIPPAPGGDLLRDGAGVLPTGRNIHALDPY
RMPSPAAYERGREIAQKIIAQHLQEHHTYPETVAVLLWGLDAIKTKGESLGILLELVGAE
PVKEGTGRIVRYELKPLAEVGHPRIDVLGNLSGIFRDSFVNIIELLDDLFQRAADADEPE
DQNFIRKHALALKAQGVENASARLFSNPAGDFGSLVNDRVVDGNWESGEELGNTWQSRNV
FSYGRQDKGQARPEVLQELLKTSDRIVQEIDSVEYGLTDIQEYYANTGGLKKAAEKQSGK
KVTASFVESFSKDTTPRNLEDLLRMEYRTKLLNPKWADAMANQGSGGAYEISQRMTALIG
WGGTADFKDDWVYDQAADTYALDPEMAEKLRQANPEAFRNILNRMLEAHGRGLWQADTDK
LDKLRQLYELTDEQLEGVTV
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcgttttgattgctggatttgaatcatttaatgctgacttgtacagaaaa
gcagcctttttggctaattctcgctgtgctgatttagatattcgggtgtttagcgatcgc
gatattaccagcaaacgtctggaagtggaagcggccttgcaaggcgcggatgtgtttttt
ggtagcctactatttgattatgaccaagttgtgtggttgcgcgatcgcgtttcccaaatt
cccatccgcttagtatttgagtcagccttagaattgatgagtttaactaaactgggtgct
ttcgccattggtgataaaccaaagggaatgcccaaacctgttaaatttattctcgacaaa
ttcagcaacggacgagaagaagacaaactcgcgggttatattagctttttaaaaatcggc
cccaaactcttaaaatttgtcccagtgcagaaagtccaagacttacgcaactggttaatt
atctatggttattggaacgccggcggcactgaaaacgtggctgctttattttggacgcta
gcagaaaaatatttagatttaaaaatcggtgacattcccccaccaattgaaacccccaac
ataggtttattgcatcccgattatccagggttttttgcatccccccgcgaatatttggca
tggtatcaaacccatccccgcaacgtcgccacaaatccagttgttggtattctcctctac
cgtaaacacgtcatcaccaaacaaccctatattccccaattaattcgccgctttgaagat
gcgggtttcattcccttacctatttttatcaacggcgtagaaggacacgttgcggtacgg
gattggatgacgactgactacgaatttcagcaacgccaaatcggtaatattgccacaccc
tcactatccccagaagccgttaaagttgatgcaattgtttccactattggctttcctctg
gtcggtggcccggcgggttcaatggaagctggtcgtcaggtggaagtagccaagcgcatt
cttaccgccaaaaatgttccttatattgtcgctgcacctttattaattcaagatatccat
tcatggacacgtcaaggtgtgggtggtttgcaaagcgtagtgttatacgccttaccagaa
ttagacggtgcaattgataccataccccttggtggtttggtgggtgaagatatttattta
gttcctgaacgggtacagcgtctcattggtagagttaaaagctggattgctttacgccaa
acacccccagcagaacggaaaattgccatcatcttatatgggttccctcctggttatggg
gctacgggtacggctgcattattaaatgttcctcgtagtttgattaaattactccacgcc
ctcaaagaccaaggttacaacgtcggcgatatcccagaagatggggaagaattaattcgt
ctggtgaaggaaactgatgaagagatggaaagatgggagaaaaataaaccttttccttct
tcagctaatactgttaattcccgtaaattggaaaaatggttgggatatctccgcacttcc
cgtatcgaaaaacaatggaaatctttgacaggtagcggaatcaaaacctacggtgatgaa
cttcatgttggtggtgtgcagttaggaaacgtgtggataggtgtccagccaccattgggg
atacaaggcgaccctatgcgcctgatgtttgaacgtgatttaacaccccatccccaatat
gctgctttttacaaatggttgcaaaatgaattacaagctgatgctgttgtccattttggt
atgcacgggactgtagaatggttacccggttcacctttgggtaatactggttattcctgg
tcagatattttgttgggagatttgcccaatctatatatatatgcagccaataatccttcc
gagtcgattttggccaagcgtcgcggttatggggtgctaatttctcacaatgtcccgcct
tatggtcgcgctgggttatataaggaattaattacactgcgggatttaattgcagaatat
cgagaagacccgcaaaagaattatgtcttgaaagaagggatttgtaaaaagattgttgat
acaggtttagatacagattgcccctttgaagatgccaaacgcttgggtatttccttcact
ccagaaaatatcagaatgtttagcgcccatgcttttgatgattatttggtgaaattatat
gagtatttgcaagttttagaaacgcgcttgttttcttctgggttacatacattaggtgaa
gcaccaaatcaagaagaattagcgtcttatctcaatgcttattttggtgaagaacaatca
aaagacccagaaattgagcagcaaattacagatttgttaatgcaaactacagatgaatta
actaatttattacgcggattaaatggtgaatacattcccccagcaccgggaggcgatttg
ttacgggatggtgctggtgtattacccacaggtcgaaatattcacgctttagacccctat
agaatgccatcccccgcagcttatgaacggggtcgagaaattgctcaaaaaatcatcgcc
cagcatttacaagaacatcatacatatcccgaaaccgtagcagttttattgtggggattg
gatgcgattaaaactaagggtgaatctttagggattcttttagaattagtcggtgctgaa
cctgtgaaagaaggaacaggtcgcattgtgcgttatgaattgaagcctttagcagaagtc
ggacatccccgtattgatgtgttaggaaatctgtcaggaatttttagagatagttttgtc
aacatcattgaattattagatgatttatttcaaagagctgctgatgctgatgaaccagaa
gaccagaattttattagaaaacacgctttagctttaaaagcccaaggcgtagaaaatgct
tccgcgagattattttccaatcctgcgggtgattttggttctttggtcaatgatagagtt
gttgatggtaactgggaatctggcgaagagttaggcaatacttggcaaagtcgcaatgtg
tttagctatggcagacaagacaaaggacaagctagaccagaagtattgcaggaacttttg
aagacgagcgatcgcattgtgcaagaaatagattcggtagaatatggtttaaccgatatt
caggaatattacgccaacaccggcgggttgaaaaaagcagccgaaaagcaaagcggtaag
aaagttacggctagttttgtcgaaagtttctctaaagacaccacaccccgcaacttagaa
gatttattgcggatggaataccgaactaaattacttaatcccaaatgggctgatgcaatg
gcgaatcaaggttccggtggcgcttatgaaatttcccaacgcatgacagccctaatcggt
tggggtggtacggctgattttaaagatgattgggtttatgaccaagctgctgatacttat
gctttagaccccgaaatggcagagaaactacgccaagccaacccagaagcttttcgtaat
atcctcaacaggatgttagaagcgcatggacggggtttatggcaagctgatacagataag
ttagataagttgcgtcagttgtatgagttgacagatgaacaattggaaggtgtgacggtt
taa

DBGET integrated database retrieval system