KEGG   Anabaena variabilis: Ava_1949Help
Entry
Ava_1949          CDS       T00277                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ava  Anabaena variabilis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ava_1949 (folE)
Enzymes [BR:ava01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Ava_1949 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2423498..2424148
Genome map
AA seq 216 aa AA seqDB search
MTLSIRPDTVSAAQMVSSLSTQQTPTVTEAEMVQAVRTLLIGLGENPDREGLLDTPKRVV
KALQFLTKGYNESLDELLNGAVFTEDANEMVLIRDIDIFSSCEHHILPIIGRAHVAYIPN
GKVIGLSKIARVCEMYARRLQVQERLTLQIADALQGLLKPQGVAVVVEATHMCMVMRGVQ
KPGSWTVTSAMRGVFAEDARTREEFMNLVRHNANFH
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgactttatcgattcgtcccgatacagtttctgctgctcagatggtatcttctttatct
actcagcaaacaccaactgtcacagaagcagaaatggtacaggctgtgcgtactttacta
attggattaggagaaaatcctgaccgtgaagggttgctagatactcctaagcgagtggta
aaagctttgcagtttttgactaagggatacaatgaatccttagatgaactgttaaatggt
gcagtatttacagaagatgccaatgaaatggtattgattcgggatatcgacattttcagt
tcttgtgaacatcatattttgccaattattggtcgcgctcatgttgcctatattcccaat
ggtaaggtgataggattatctaaaattgcgcgagtttgtgagatgtacgctcgacgttta
caagtacaggaacgtctgacgctacaaattgctgatgcactgcaaggtttactcaaacct
caaggggtagcagtggtagtagaagcaactcatatgtgcatggtgatgcgtggtgtacaa
aagcctggttcttggactgtaactagtgcaatgcgtggtgtatttgcggaagatgctcgc
actcgtgaagagtttatgaatttagtacgacataatgctaattttcactaa

DBGET integrated database retrieval system