KEGG   Anabaena variabilis: Ava_2080Help
Entry
Ava_2080          CDS       T00277                                 

Definition
inorganic carbon transport
Orthology
K05583  
NAD(P)H-quinone oxidoreductase subunit L [EC:1.6.5.3]
Organism
ava  Anabaena variabilis
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NAD(P)H:quinone oxidoreductase, chloroplasts and cyanobacteria
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:ava00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2572170..2572382
Genome map
AA seq 70 aa AA seqDB search
MIVPLLYLALAGAYLLVVPVALMFYLKQRWYVVSSVERTFMYFLVFLFFPGLLVLSPFVN
LRPRPRKIEV
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgattgtacccctgctatatctggctttagccggagcttacttattagttgtccctgtt
gctttaatgttttacttaaagcagcgctggtatgtggttagctctgttgagcgcaccttt
atgtattttctagtgttcttgttctttccggggctattggttttatccccattcgtaaac
ctgcgcccccgtccacgcaaaatcgaagtttaa

DBGET integrated database retrieval system