KEGG   Anabaena variabilis: Ava_2080Help
Entry
Ava_2080          CDS       T00277                                 

Definition
inorganic carbon transport
Orthology
K05583  
NAD(P)H-quinone oxidoreductase subunit L [EC:1.6.5.3]
Organism
ava  Anabaena variabilis
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NAD(P)H:quinone oxidoreductase, chloroplasts and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Ava_2080
Enzymes [BR:ava01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     Ava_2080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2572170..2572382
Genome map
AA seq 70 aa AA seqDB search
MIVPLLYLALAGAYLLVVPVALMFYLKQRWYVVSSVERTFMYFLVFLFFPGLLVLSPFVN
LRPRPRKIEV
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgattgtacccctgctatatctggctttagccggagcttacttattagttgtccctgtt
gctttaatgttttacttaaagcagcgctggtatgtggttagctctgttgagcgcaccttt
atgtattttctagtgttcttgttctttccggggctattggttttatccccattcgtaaac
ctgcgcccccgtccacgcaaaatcgaagtttaa

DBGET integrated database retrieval system