KEGG   Trichormus variabilis: Ava_2082Help
Entry
Ava_2082          CDS       T00277                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ava  Trichormus variabilis
Pathway
ava00260  Glycine, serine and threonine metabolism
ava00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
ava01130  Biosynthesis of antibiotics
ava01230  Biosynthesis of amino acids
Module
ava_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ava_2082
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ava_2082
Enzymes [BR:ava01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ava_2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth TMP-TENI PcrB ThiG NanE PucR ALF
Motif
Other DBs
NCBI-ProteinID: ABA21704
JGI: Ava2082
CyanoBase: Ava_2082
CYORF: Ava_2082
UniProt: Q3MBD2
Position
2572862..2573662
Genome map
AA seq 266 aa AA seqDB search
MTAISDRFETLKQNQECALIPFITAGDPDLETTAAALKILDSNGADIIELGIPYSDPLAD
GPVIQAAATRALQNGTKLESVLEMLKVTTPSLQAPIVLFTYYNSILHRGIDNFLEQVAAA
GVAGLVVPDLPLEEAAGLLKPATERGIDLILLIAPTSSSERIEAIARSSQGFIYLVSVTG
VTGMRSQVEGRVLDLLQKVRQVTDKPLGVGFGISQPAQATQVRDWGADAAIVGSAFVQRL
ATGTPAEGLSAIAEFCQSLKAAIKTS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaatttccgatcgctttgaaaccctcaaacagaatcaagagtgtgcgctgatt
ccgtttattactgctggtgatcctgatttagaaactacggctgccgccttaaagatttta
gatagtaatggtgctgacataattgaattaggcattccttactccgatcctttggcagat
gggccagtaattcaagcagccgctactcgtgctttacaaaatggcacaaaactggaaagt
gtgctggaaatgttaaaagtcaccacacccagtttgcaagcaccgattgttttatttact
tattacaattctattctgcaccgagggattgacaatttccttgagcaagttgctgctgct
ggtgtcgccggcttggtagtaccggatttacccttagaagaagccgcaggactacttaaa
cccgctactgaacgggggattgatttaattctgttgattgcccctacaagttcatctgag
agaatagaagcgatcgctcgttcatcacaaggatttatctatttggttagtgtcacaggt
gttaccgggatgcgatcgcaagtagaagggcgtgtgcttgatttattacaaaaagttcgg
caagtaaccgataaacccctcggtgttggttttggcatatctcaacccgcacaagcaact
caggtgagagattggggagcagatgccgctattgtgggtagcgcttttgtccaacgccta
gccacaggaacaccagcagaaggactcagtgcgatcgcggaattttgtcaaagtctgaag
gcagccatcaaaacatcttga

DBGET integrated database retrieval system