KEGG   Anabaena variabilis: Ava_2082Help
Entry
Ava_2082          CDS       T00277                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ava  Anabaena variabilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ava_2082
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ava_2082
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ava_2082
Enzymes [BR:ava01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ava_2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2572862..2573662
Genome map
AA seq 266 aa AA seqDB search
MTAISDRFETLKQNQECALIPFITAGDPDLETTAAALKILDSNGADIIELGIPYSDPLAD
GPVIQAAATRALQNGTKLESVLEMLKVTTPSLQAPIVLFTYYNSILHRGIDNFLEQVAAA
GVAGLVVPDLPLEEAAGLLKPATERGIDLILLIAPTSSSERIEAIARSSQGFIYLVSVTG
VTGMRSQVEGRVLDLLQKVRQVTDKPLGVGFGISQPAQATQVRDWGADAAIVGSAFVQRL
ATGTPAEGLSAIAEFCQSLKAAIKTS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaatttccgatcgctttgaaaccctcaaacagaatcaagagtgtgcgctgatt
ccgtttattactgctggtgatcctgatttagaaactacggctgccgccttaaagatttta
gatagtaatggtgctgacataattgaattaggcattccttactccgatcctttggcagat
gggccagtaattcaagcagccgctactcgtgctttacaaaatggcacaaaactggaaagt
gtgctggaaatgttaaaagtcaccacacccagtttgcaagcaccgattgttttatttact
tattacaattctattctgcaccgagggattgacaatttccttgagcaagttgctgctgct
ggtgtcgccggcttggtagtaccggatttacccttagaagaagccgcaggactacttaaa
cccgctactgaacgggggattgatttaattctgttgattgcccctacaagttcatctgag
agaatagaagcgatcgctcgttcatcacaaggatttatctatttggttagtgtcacaggt
gttaccgggatgcgatcgcaagtagaagggcgtgtgcttgatttattacaaaaagttcgg
caagtaaccgataaacccctcggtgttggttttggcatatctcaacccgcacaagcaact
caggtgagagattggggagcagatgccgctattgtgggtagcgcttttgtccaacgccta
gccacaggaacaccagcagaaggactcagtgcgatcgcggaattttgtcaaagtctgaag
gcagccatcaaaacatcttga

DBGET integrated database retrieval system