KEGG   Anabaena variabilis: Ava_2103Help
Entry
Ava_2103          CDS       T00277                                 

Definition
cytochrome P450 (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
ava  Anabaena variabilis
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Ava_2103
  Amino acid metabolism
   00380 Tryptophan metabolism
    Ava_2103
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Ava_2103
Enzymes [BR:ava01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Ava_2103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2597964..2599331
Genome map
AA seq 455 aa AA seqDB search
MKLPDSPKIPRFMQLVQWIYQPLQLMEASAKAHGDCFTLWLTNKRPIVFLSNPQAIQELF
TTPLEQLDARGTAQVLQPLLGENSLLLLSGETHQRQRKLLTPPFHGDRMRAYGDIITNIT
QEVISKWQLGEPFSVRDSMQEITLRVILQAVFGLREGERYTQLQKRLCDILDLSGSALRS
TLSFLPALQIDLGSWSPWGHFLRQRAAIDQLLYAEIQDRRDHPDPSRTDILSLMMAARDE
NGEAMTDIELRDELMTLLVAGHETTASALTWALYWIHKLPQVREKLLAELDNFGDNGDVN
EITRLPYLTAVCQETLRIYPIAMVTIPRIVKTTLEIGGHQFAPGTMLVGCIYLMHRRPDL
YPQPQEFKPERFLEKQYSLYEYLPFGGSNRRCVGMAFALYEMKLVLATVLANMDLALVDN
YPVKPTRRGVTLAPSGGKWLIATGQHQKVKSPVEV
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttccagatagtccaaagataccaagatttatgcagctagtgcagtggatttat
cagccattgcaactaatggaagcatctgccaaagctcacggggattgttttacactatgg
ctgacaaacaaacgaccaatagtatttttgagtaacccacaagcaattcaagaacttttt
actactccattagaacaattagacgctagaggaacagcccaagttttacaacctttacta
ggagaaaattctttactgttgctgtctggagaaactcaccagcgtcagcgtaagttgtta
acgccgccttttcatggcgatcgcatgagggcttacggcgatatcattactaacatcacc
caagaagtcattagtaaatggcaattaggcgaacccttctctgtgcgcgactccatgcag
gaaatcacattgcgggtaattttacaagctgtttttggtttacgtgagggagaacgttac
acccaactacaaaaacgcctctgtgacatcttagatttgagtggttctgccttacgttct
accctatcctttttgcctgcattgcagatagacttaggtagttggagtccttggggtcac
ttcttgcgtcaaagagctgcaattgaccaactactttacgccgaaattcaagaccgcaga
gatcatccagacccatcccggactgatatcctgtccttgatgatggcggcgcgggatgaa
aatggtgaagccatgactgatatcgagttgcgggatgaattgatgacgttgttagtcgca
ggtcatgaaaccaccgcctcagctttgacatgggctttatactggattcacaaattaccg
caagtacgagagaaacttctggctgagttagataattttggtgacaatggcgacgtaaat
gaaattactcgcctaccttatttaacggctgtctgtcaggagacactacgcatttatccc
attgcgatggtgaccatcccgcgtattgtcaagacaactttagaaattggtggtcatcaa
tttgcaccaggaacaatgcttgtaggctgcatttatttaatgcaccgccgaccagattta
tatccccagccgcaagagtttaagccagaaaggtttttagaaaagcagtattcattatat
gaatatctaccatttggtggcagtaaccgtcgctgtgtgggtatggcttttgccttgtat
gaaatgaaattggttttggcaacagtattagcaaatatggatttagcattagttgataac
tatccagtcaaacccacccggcgcggtgtcaccttagcaccctccggcggtaaatggtta
attgctacgggacaacatcaaaaagtcaaaagccctgtagaagtatag

DBGET integrated database retrieval system