KEGG   Trichormus variabilis: Ava_2150Help
Entry
Ava_2150          CDS       T00277                                 

Definition
(GenBank) Response Regulator Receiver Signal Transduction Histidine Kinase
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HATPase_c HisKA HATPase_c_5 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ABA21770
JGI: Ava2150
CyanoBase: Ava_2150
CYORF: Ava_2150
UniProt: Q3MB66
Position
2660863..2662194
Genome map
AA seq 443 aa AA seqDB search
MLDTSTETSFILVVDDTLTNLEIISEALIGAGFEVATAVDGKKALEQIQSRVPDLILLDV
MMPVMDGFETCKNLKIQPETHDIPVIFMTAITDTNSKVEALSLGAVDYITKPFHKAEVLA
RISAHLQLRSLNKNLEKRVIERTAELNQALKDLQEYQLQLVQQEKMSVLGQLVAGLAHEI
NNPVSCIYGNLGHALTYFENMDKLINLYQSYYPQPVQEIQNEISEMDLAYVRSDLPNLIF
SMKEGIQRIRDISRSLRIFSRSDTEKKIQFDIHEGIDSTILILKHRLKGSENHPDIEIKR
DYGVIPQVNCFPGQLNQVFMNILANAIDALEESFSNNYYSVIDSEITVNQEMMAETPQII
IQTILSEDESYALIKIKDNGIGMPQQIKERIFDNLFTTKPVGKGTGLGLSIARQIIIQKH
GGKLEVNSEPGRGSEFIINIPIE
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatacatcaaccgaaactagctttattttagttgtagatgataccctcaccaat
ctcgaaattatctctgaagcattgattggcgcaggttttgaagtagccaccgcagttgat
ggaaaaaaagcgctcgaacagatacaaagtagagtgccagatttaattctgttggatgta
atgatgccggtaatggacggatttgaaacctgtaaaaacttgaaaattcagccagaaact
cacgatattcccgtgattttcatgacagcaattactgatacaaatagtaaagtagaagcc
ttaagtttaggcgcagttgattacattactaagccattccataaagcagaagttttggct
cgtatttctgcccatctgcaactgagaagcttgaataaaaatttagaaaaacgagttatt
gaacgcacggctgaattgaatcaagcattgaaagacctacaagagtatcaactccaactt
gtacaacaggaaaaaatgtctgtgcttggacaattagtagcaggattagctcatgaaatt
aataacccagtcagttgtatttatggcaatttaggtcacgctttgacgtattttgaaaat
atggataagctgattaatttatatcaaagttattatccccagcctgtacaagaaattcaa
aacgaaatcagtgaaatggatttagcctatgtgcgttctgacctgcccaatttaattttc
tctatgaaagaaggcattcagcgcatccgagatattagcaggagtctacgtattttttcc
aggtcagacacagaaaaaaaaattcagtttgatattcatgaagggattgatagtactatt
ttaatactcaagcatcgattgaaaggatctgagaatcaccctgacattgaaattaaacga
gattatggtgtcatacctcaagttaactgctttcctgggcaattgaatcaggtgttcatg
aatattttagctaatgcaattgatgccttagaagaatcatttagtaataattattattca
gtaatagatagtgaaattactgttaatcaggaaatgatggctgagactccgcagatcata
attcagacaatactgagtgaagatgaaagttatgctttaattaaaattaaagataacggc
ataggaatgccacagcaaattaaagagagaatttttgataatttgtttactactaaacct
gtaggtaaaggtacaggtttaggattatcaattgctcggcaaattatcattcaaaaacat
ggtggtaaacttgaggtaaattcagaaccaggaagaggctcagaatttattattaacatc
cccattgaataa

DBGET integrated database retrieval system