KEGG   Anabaena variabilis: Ava_2252Help
Entry
Ava_2252          CDS       T00277                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ava  Anabaena variabilis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ava_2252
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Ava_2252
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ava_2252
Enzymes [BR:ava01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Ava_2252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2802629..2804197
Genome map
AA seq 522 aa AA seqDB search
MELINRNFLATHCKRRNFLLGAGLITGLVVASQWHPVMAQTRFSGYPFSLGVASGDSLPD
SVVLWTRLAPDPVNGGGMSPVNVPVQWQIARDENMTQVVQKGTVLATPELAHSVHVDVRG
LEPDRWYWYQFKVGNEVSPKGRTRTAASPHSSIQKFNFAFASCQDWQNGFYTAYKHMAEE
DLDLVVHLGDYIYEYGPRSGAPRQHIGPEIVTLSDYRNRYALYRTDVNLQAAHANFPWIF
TWDDHEVDNNYANFIPEDNQSRQAFERRRANAYQAYYEHMPLRLSSLPKQSSMLLYRRLT
FGDLAEFNVLDTRQYRTDQPCNDGLKPLCNAALDAAATMTGARQEGWLLRGLDKSKARWN
IIAQQTMLGQFDFDARPDSQVFNVDQWDGYVAARNRLLSFFAQRRPSNPVVITGDIHSSW
VHDLKADFNNPLSATVGTEFVGTSITSSFPTNSIAPVRAALSNNPHTKFFDGAYRGYVRC
QLTRERWQTDYRVVSSILEENASISTLASFVVENGQPGAKTA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggaattaataaatcgcaacttccttgcaacccattgcaaacgcaggaattttttactg
ggtgcaggactaatcacagggttagtagtagccagtcaatggcatcctgtgatggcgcaa
acaagattttctggctatccatttagtctaggtgttgcctctggagattccttacctgat
agcgtggtgttatggacaagactagcaccagatccagtcaacggcggtggtatgtcacca
gtgaatgttcctgtgcagtggcaaatcgcacgggatgaaaatatgacacaggttgtacaa
aaaggaacagtcttagcaacacccgaactagctcactcagtacacgttgatgtccgtggg
ctagagcctgatcgttggtactggtatcaattcaaagtaggtaatgaagtcagccccaaa
ggacgtacacgtacagccgcatcacctcatagctctattcaaaaatttaatttcgccttt
gcttcttgccaagattggcagaatggcttttacacagcctacaaacacatggctgaagaa
gaccttgacttagttgtgcatctaggtgactacatctatgagtatgggcctcgctctggt
gcgccacgtcagcatatcggcccagaaatcgttactcttagcgattaccgaaaccgctat
gctttgtatagaactgacgtaaatttacaagcagctcatgctaacttcccttggattttt
acttgggatgaccatgaagtagataacaactatgccaacttcattcccgaagataaccag
agtcggcaagcatttgagcgccgacgagccaatgcttaccaagcttactatgagcatatg
ccattgcgcctatcctccttgcccaagcaatctagtatgctgctatatcgacggttaact
tttggggatttagctgagttcaatgtcttagatactcgccaataccggactgaccaacct
tgtaatgatggactcaagccactgtgtaacgcagctttagacgcagccgccaccatgaca
ggtgcaagacaagaaggttggttactcagaggactagacaaatcaaaagcacgctggaat
ataattgctcaacaaacaatgcttggtcaatttgattttgatgctcgtcccgattcccaa
gtcttcaacgttgaccaatgggatggttatgtcgcggctcgtaatcgcctcttgagtttt
ttcgcacagcgtagaccctcaaacccagtagtaattactggagatatccattccagttgg
gtacatgatttaaaagctgactttaataatccactgtcagcaaccgtagggactgagttt
gtgggtacttccattacttctagctttcctacaaattccattgcaccagttagagcagct
ttgagcaacaacccccatacaaaattcttcgatggtgcttatcgcggttatgttcgttgc
caactaactagagaacgttggcaaactgattaccgtgtggtgtccagcatccttgaagag
aatgcttctattagcaccctcgcttcctttgtggtagaaaacgggcagccaggtgcaaaa
acagcgtga

DBGET integrated database retrieval system