KEGG   Trichormus variabilis: Ava_2253Help
Entry
Ava_2253          CDS       T00277                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  recombination protein RecR
Organism
ava  Trichormus variabilis
Pathway
ava03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ava00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ava_2253
DNA repair and recombination proteins [BR:ava03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Ava_2253
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Ava_2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: ABA21871
JGI: Ava2253
CyanoBase: Ava_2253
CYORF: Ava_2253
UniProt: Q3MAW5
Position
2804453..2805010
Genome map
AA seq 185 aa AA seqDB search
MQRLPGVGPKTAQRLALHILKRPESEVEALAQALVEAKKQIGLCSVCFHLSSEPVCEICR
NPNRENNTICVVADSRDVIALEKTREFKGKYHVLGGVISPMDGIGPEQLTITPLLRRVSQ
QQPKEVILAISPSVEGETTTLYVGQLLKPFTKVTRIAFGLPVGGDLEYADEITLARALEG
RRELD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgcaacgcctccctggagttggtcccaaaacagcccagcgcctagccttgcatattttg
aagcgaccagaatctgaagtagaagctttagcacaagctctagttgaggcgaaaaagcag
ataggcttgtgttctgtctgttttcacttatcttctgaaccagtttgtgaaatctgccgc
aatcctaaccgtgaaaataatactatctgcgtagtagcagattcccgcgatgtgattgcc
ctagagaaaacccgcgaattcaaaggtaagtatcatgtcctgggtggggtgatttcgccg
atggatggaattggcccagaacagttgaccataactcctttgttgcggagggtcagtcaa
cagcaaccaaaagaagtgattttagcaattagtcccagcgtcgaaggggaaaccacaaca
ttgtatgttggtcaactattgaaaccatttactaaagtgacaagaattgcctttggtttg
cccgtagggggagatttagaatacgctgatgagattacactggcaagagctttagaagga
cgcagagaattagattaa

DBGET integrated database retrieval system