KEGG   Anabaena variabilis: Ava_2253Help
Entry
Ava_2253          CDS       T00277                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ava  Anabaena variabilis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ava00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ava_2253 (recR)
DNA repair and recombination proteins [BR:ava03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Ava_2253 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2804453..2805010
Genome map
AA seq 185 aa AA seqDB search
MQRLPGVGPKTAQRLALHILKRPESEVEALAQALVEAKKQIGLCSVCFHLSSEPVCEICR
NPNRENNTICVVADSRDVIALEKTREFKGKYHVLGGVISPMDGIGPEQLTITPLLRRVSQ
QQPKEVILAISPSVEGETTTLYVGQLLKPFTKVTRIAFGLPVGGDLEYADEITLARALEG
RRELD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgcaacgcctccctggagttggtcccaaaacagcccagcgcctagccttgcatattttg
aagcgaccagaatctgaagtagaagctttagcacaagctctagttgaggcgaaaaagcag
ataggcttgtgttctgtctgttttcacttatcttctgaaccagtttgtgaaatctgccgc
aatcctaaccgtgaaaataatactatctgcgtagtagcagattcccgcgatgtgattgcc
ctagagaaaacccgcgaattcaaaggtaagtatcatgtcctgggtggggtgatttcgccg
atggatggaattggcccagaacagttgaccataactcctttgttgcggagggtcagtcaa
cagcaaccaaaagaagtgattttagcaattagtcccagcgtcgaaggggaaaccacaaca
ttgtatgttggtcaactattgaaaccatttactaaagtgacaagaattgcctttggtttg
cccgtagggggagatttagaatacgctgatgagattacactggcaagagctttagaagga
cgcagagaattagattaa

DBGET integrated database retrieval system