KEGG   Trichormus variabilis: Ava_2265Help
Entry
Ava_2265          CDS       T00277                                 

Definition
(GenBank) ROK
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ava  Trichormus variabilis
Pathway
ava00010  Glycolysis / Gluconeogenesis
ava00052  Galactose metabolism
ava00500  Starch and sucrose metabolism
ava00520  Amino sugar and nucleotide sugar metabolism
ava00521  Streptomycin biosynthesis
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
ava01120  Microbial metabolism in diverse environments
ava01130  Biosynthesis of antibiotics
ava01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ava_2265
   00052 Galactose metabolism
    Ava_2265
   00500 Starch and sucrose metabolism
    Ava_2265
   00520 Amino sugar and nucleotide sugar metabolism
    Ava_2265
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ava_2265
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Ava_2265
Enzymes [BR:ava01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ava_2265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABA21883
JGI: Ava2265
CyanoBase: Ava_2265
CYORF: Ava_2265
UniProt: Q3MAV3
Position
2820421..2821356
Genome map
AA seq 311 aa AA seqDB search
MISAVVVWCEELNVGNSQVIGIDLGGTAIKLGRFSEDGTCSQSLTVETPQPATPEAVFLV
MVDAIAQIDPDNETIAIGVGTPGPADAQGRIAQIAINLPQWENVPLADWLETKTNKPTVI
ENDANCAGIAEAWLGAGRHYQNFIMLTLGTGVGGAIFLDGKLFVGHRGAAGELGLITLQP
DGPMCKSGNPGSLEQYTSIKAIRRLTGKEPAELGMLAQAGDIEALQFWQEYGQNLGIGLT
SLIYVLTPQAIVLGGGVSASHEFFLPTLKAEIEQRVMSTSRAGLQILPAELGNSAGMVGA
ARLAWKKFGNG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgatttctgctgtggtggtttggtgtgaggaattgaacgtggggaattctcaagtaatt
ggcattgacttggggggaacagcaattaaactggggcgatttagcgaagatgggacttgt
tcacaatctttgactgtagagactccccaaccagcaaccccagaagcggtttttctggta
atggtggatgcgatcgcgcaaattgacccagataatgaaactatagctattggtgtgggt
actcctggcccggctgatgctcaaggacgcattgcccaaattgcgattaacttaccccaa
tgggaaaatgtgcctttagctgattggttagaaacgaaaactaacaagccgacagtaatt
gaaaatgatgccaactgtgcaggaatcgctgaggcgtggttaggagccggtcgccactac
caaaactttatcatgctaactttggggactggcgttggtggcgcaatttttttagacggt
aaattatttgttggacatcgcggcgcggctggggaattgggattaattacactccaacca
gatggccccatgtgtaaaagtggcaaccctggttctttagaacagtacacttccattaaa
gctattcgtcgcctgactggtaaagaacctgcggagttaggtatgctagctcaagctgga
gatatagaagccttacaattttggcaagaatacggacaaaatttaggtataggtttaact
agtttaatttatgttctcacaccacaggcgatcgtgcttggcggtggtgtcagtgccagc
catgagtttttcttaccaactctcaaagccgaaatcgaacagcgagtcatgtccacatcc
cgcgcaggcttacaaatcttgccagcagagttgggtaactcagccggtatggtaggtgca
gcaagattagcttggaaaaagtttggtaatgggtaa

DBGET integrated database retrieval system