KEGG   Trichormus variabilis: Ava_2498Help
Entry
Ava_2498          CDS       T00277                                 

Definition
(GenBank) Protein of unknown function DUF433
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF433
Motif
Other DBs
NCBI-ProteinID: ABA22113
JGI: Ava2498
CyanoBase: Ava_2498
CYORF: Ava_2498
UniProt: Q3MA73
Position
complement(3091535..3091753)
Genome map
AA seq 72 aa AA seqDB search
MLKYSSIISTSPEIMGGTPVFTGTRVPVETLLDYLKAGESIDDFLDGFPTVTREQVIAFL
EETRKQIVDAVA
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaatactcctcaattattagcacatcgccagaaattatgggtggaacacccgtc
tttacaggtactagagttcccgtggagacacttttggactatctcaaagccggagagtcg
attgacgattttttagatggatttccgactgtaactagagagcaagttattgcattttta
gaagagacaaggaaacaaattgttgacgcggtagcatag

DBGET integrated database retrieval system