KEGG   Trichormus variabilis: Ava_2513Help
Entry
Ava_2513          CDS       T00277                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3107
Motif
Other DBs
NCBI-ProteinID: ABA22128
JGI: Ava2513
CyanoBase: Ava_2513
CYORF: Ava_2513
UniProt: Q3MA58
Position
3107758..3108030
Genome map
AA seq 90 aa AA seqDB search
MFTIDLSIKNTAFPITVQRKTAEDAEAVYQLILAAIRSGNPDIVELKCEGKTEKKIAVRA
SEISGVQITQKDGVTTSSGRAPGFFALAGE
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgtttaccattgatttaagcatcaagaacactgccttcccaataacagtgcaacgtaag
acagcagaggacgctgaggctgtttatcagctgattttggcagcgatccgctctggtaat
cctgatattgtggaactgaagtgtgagggcaagacagagaaaaaaattgctgtccgcgct
agtgaaatttctggagtccagattactcagaaagatggtgtcactacaagtagtggtaga
gcgcctggattttttgccctagcgggtgagtaa

DBGET integrated database retrieval system