KEGG   Trichormus variabilis: Ava_2551Help
Entry
Ava_2551          CDS       T00277                                 

Definition
(GenBank) transcription antitermination protein nusG
  KO
K02601  transcriptional antiterminator NusG
Organism
ava  Trichormus variabilis
Brite
Transcription machinery [BR:ava03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     Ava_2551
Ribosome biogenesis [BR:ava03009]
 Prokaryotic Type
  rRNA transcription factors
   Ava_2551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NusG KOW
Motif
Other DBs
NCBI-ProteinID: ABA22166
JGI: Ava2551
CyanoBase: Ava_2551
CYORF: Ava_2551
UniProt: Q3MA20
Position
3153253..3153885
Genome map
AA seq 210 aa AA seqDB search
MTSATDEPTNSALQSEETAETALTEARWYAVQVASGCEKRVKTNLEQRIQTFDVAEKIVQ
VEIPHTPAVKIRKDGSRQHTEEKVFPGYVLVRMVMDDDTWQVVRNTSHVINFVGAEQKRG
TGKGRGHVKPLPLSHSEVERIFKQTTEQEPIVKIDMASGDKIIVLSGPFKDFEGEVIEVS
PERSKLKALLSIFGRDTPVELEFNQVEKQS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgcgacagacgaaccaacaaactcggcgttgcagtcagaggaaacagcagaa
acagcacttacagaagcacgctggtatgcagtacaagtagcctcaggctgcgaaaagcgg
gtaaaaacaaatttagagcagcgcattcaaacttttgatgtggcggaaaaaattgtccag
gtagaaattccccacacaccagcagtcaaaatccgtaaggatggcagccgccaacacaca
gaagagaaagtatttcctggctatgtgttagtgcggatggtgatggatgatgatacctgg
caggtggtacgtaatacatcccatgtaattaactttgtgggagcagaacaaaaacgtggt
acaggcaaaggccgcggtcacgttaaaccactacccctaagtcactcagaagtagaacgt
atctttaaacaaaccacagaacaagagccaattgtcaaaattgacatggctagtggtgat
aagataatcgtgctttctggcccattcaaggactttgaaggtgaggtaattgaggttagt
ccagaacggagtaaactaaaagccttgctatcgatcttcgggcgagacacaccagtagaa
ctggaatttaatcaggtagaaaaacagagctaa

DBGET integrated database retrieval system