KEGG   Trichormus variabilis: Ava_2555Help
Entry
Ava_2555          CDS       T00277                                 

Definition
(GenBank) LSU ribosomal protein L12P
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
ava  Trichormus variabilis
Pathway
ava03010  Ribosome
Module
ava_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ava00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Ava_2555
Ribosome [BR:ava03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Ava_2555
  Bacteria
    Ava_2555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N DUF3335 Ribosomal_L27A
Motif
Other DBs
NCBI-ProteinID: ABA22170
JGI: Ava2555
CyanoBase: Ava_2555
CYORF: Ava_2555
UniProt: Q3MA16
Position
3156095..3156481
Genome map
AA seq 128 aa AA seqDB search
MSAATDQILDQLKSLSLLEAAELVKQIEEAFGVSAAAPVGVAVAAPAAAAAAEPVEEQTE
FDVILESVPADKKIAVLKIVREITGLGLKEAKDLVEAAPKAVKEAIAKDAAEDAKKRIEE
AGGKVTIK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgcaaccgatcaaattttagaccaattaaaatctctgtctctgttagaagct
gctgagttagttaagcaaattgaagaagcttttggcgtaagtgctgctgcacccgttggc
gtagctgtggctgctcctgcggcggcggctgctgctgaaccagtagaagaacaaaccgag
tttgatgtcattctcgaatctgttcctgctgataagaagattgcagttctgaagattgtc
cgcgaaatcactggtctaggcttgaaagaagctaaagacttagtagaggctgcacctaaa
gcagttaaggaagcgatcgctaaagatgcggctgaagatgctaagaagcggattgaagaa
gctggcggtaaggtaacaattaagtaa

DBGET integrated database retrieval system