KEGG   Trichormus variabilis: Ava_2558Help
Entry
Ava_2558          CDS       T00277                                 

Definition
(GenBank) 3-beta hydroxysteroid dehydrogenase/isomerase
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD TrkA_N Semialdhyde_dh GDP_Man_Dehyd Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ABA22173
JGI: Ava2558
CyanoBase: Ava_2558
CYORF: Ava_2558
UniProt: Q3MA13
Position
complement(3159498..3160373)
Genome map
AA seq 291 aa AA seqDB search
MFLVTGATGDIGRRVIRLLREHDHSVRGFVRLTSRYGELEHRGADIFIGDLRREQDIEKA
CQGVQYIISAHGSDNDALTLDYRANITLIDQAKANGVQHFVFISVLGAERGYEDAPVFKA
KRAVENYLAASGLNYTILRPAGLASNLLPLAERFRETGLYLLIGDPKNRTSIVSTDDLAR
IVVDSVTVPDARNQIFSVGGPEILLREDIPQIFSHIFKKEPIVVNSPLLVIDGLRSVLGL
INPEAQQALGTFRTLLSNEFFCRKDEIAKLEQTFSFPLETLESFLRRYLAV
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtttttggtaactggagcaacaggagacattggccgcagagtgataagactcctgcgc
gaacacgatcattctgtgcgaggttttgtccgtcttacctcgcgttacggtgaactggaa
caccgaggagccgacatctttatcggtgatttgcggcgcgaacaagatatagaaaaagct
tgccaaggtgttcaatatattatcagcgcccacggctctgataacgatgcactcaccctc
gactatcgtgctaacatcacattgatcgaccaagcgaaagctaacggagtgcagcacttt
gtttttatttccgtattaggagccgaacgggggtatgaagacgctcccgtatttaaagcc
aaacgagctgtagaaaattatttggcagctagtggcttgaactacaccattttacgtccg
gctggattagcatctaacttgctacctttagcagaaaggtttcgggaaacagggttatat
ttgctaattggcgaccccaaaaaccgtacctccattgtgagtacagatgatttagcaagg
atagtagtggattcagtgactgttccagacgctcgtaatcaaatcttttccgtcgggggg
cctgagattctattacgtgaagacattccccaaattttcagtcatatctttaagaaagaa
ccaatagtggttaactcaccattattggtaattgatggattgcggagtgtcttgggttta
attaatcccgaagcacaacaggctttaggaactttccgcacattactgtccaatgaattt
ttctgtagaaaagatgagatagctaaattagagcagacctttagctttcccttggaaact
ttggaaagtttcttaaggcgttatttagctgtttga

DBGET integrated database retrieval system