KEGG   Trichormus variabilis: Ava_2572Help
Entry
Ava_2572          CDS       T00277                                 

Definition
(GenBank) hypothetical protein
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4143
Motif
Other DBs
NCBI-ProteinID: ABA22187
JGI: Ava2572
CyanoBase: Ava_2572
CYORF: Ava_2572
UniProt: Q3M9Z9
Position
complement(3180223..3181053)
Genome map
AA seq 276 aa AA seqDB search
MKVRKQRIIEGHLLELEPTLQPTYPYENLSEEEAIAQANEWLVLSSPVEPHTKVDLGGQT
LVHLGSSHVSVSSPEKLRQDKRKGKVADYMTHERLLTYADTYQRSHKLENLVVQELARQG
LNAVVLPAVADGDTKSKQADIIITNANGRKFALEVKEARYAGCTLGLPKDSSSHLAGYRR
YPQSLWVDSCSAWDAKAEACKRRGETLLGCIVLCPIGRLSDEKRTVYGLVYLPSALSDEW
EEEETCNRERYYWAYKAYRDCFCTLGDLVEEVDNYA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgagaaagcaacggattatagaaggtcatctactggagctagaaccaacgctc
cagccaacttacccatacgagaacttaagcgaagaggaagcgatagcccaagctaacgaa
tggttggtacttagttcacctgtggagcctcacacgaaagttgacttgggtgggcaaaca
ctcgttcatttaggtagttctcacgttagcgttagcagtcctgagaaactgagacaagac
aaacgtaaagggaaggtagcagactatatgacccacgaacgcctgttaacttatgccgac
acttaccaacggtcacacaagctagagaacttagtcgtccaagaactcgctaggcaaggt
ctgaatgccgtcgtgttgcctgcggtagccgatggagacactaagagcaagcaagcagac
atcataataactaacgctaacgggcgcaagtttgccttggaagtgaaagaggctcggtac
gctggctgcacactaggtctacctaaagacagcagcagtcatcttgctggctatcgccgc
tatcctcagagtctttgggttgactcatgttctgcctgggacgcgaaagctgaggcttgc
aagcgaagaggcgagacactgcttggttgtattgtcttatgccctatcggtaggttgtct
gatgaaaagcgcactgtctacgggcttgtatacttaccatctgccctcagtgatgagtgg
gaagaggaagaaacctgcaacagagaacgctattactgggcttacaaggcttaccgtgat
tgcttctgcacactaggagacttagtagaggaggtagataactatgcctag

DBGET integrated database retrieval system