KEGG   Trichormus variabilis: Ava_2592Help
Entry
Ava_2592          CDS       T00277                                 

Definition
(GenBank) Beta-ketoacyl synthase
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C KAsynt_C_assoc ACP_syn_III Thiolase_N
Motif
Other DBs
NCBI-ProteinID: ABA22207
JGI: Ava2592
CyanoBase: Ava_2592
CYORF: Ava_2592
UniProt: Q3M9X9
Position
3209345..3210706
Genome map
AA seq 453 aa AA seqDB search
MEKIAIIGLSCLFPDANNPEQFWQNLTEQKDSTSSVTVAQMGVDPTIFYDPVKGKPEKFY
FLKGGFIQNFQFDASEYNLPSEYVESLDNTFKWSLYAAKQAIKHSGYWGNQDVLSKCGVI
LGTLSFPTKLSTQLVTPIYRQTIEPAVAELLQNQDFHLAALPTATKPSLHNAMISGLPAA
LVAQAFSLSGTHFCIDAACSSAFYAIKLASHYLWTGKADVMLAGAISCSDPLFLRMLFSG
IQGYPENGISSPLDKSSRGLVTSEGIGMVMLKRYSDAVRDGDKILATVCGNGLSNDGKGK
HLLSPNTKGQVTAFERAYKEAQLSPKAIDYMECHATGTLLGDTTEFNSIESFFGEHQAAP
LIGSSKANVGHLLVAAGMVSLTKAIYGMNYGVIPPTINVNDPIGTENNVISPQNIVRTPT
AWPINTGTKHAALSAFGFGGTNSHLILEKAADL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaatcgccatcattggcttatcatgcctgtttcctgatgctaataatcctgag
caattttggcagaatctcaccgagcagaaagattcgacatcatctgtaactgttgcccaa
atgggtgtagatcccacaatattttacgacccggtaaaaggcaagccggaaaaattttat
tttctcaaaggtggatttattcaaaacttccaatttgatgctagtgaatacaatctgcca
tcagaatatgtggaaagcttggataataccttcaaatggtcgctatatgcggctaaacaa
gcaataaaacatagtggttattggggaaatcaagatgtcctatctaaatgtggagtcatt
ttaggtactctctctttcccaactaagctttctactcaactggttacacctatttatcga
caaactatagaacctgctgttgccgaacttttacaaaatcaagattttcatctggctgct
ttacctacagcaactaaaccatctctacataatgcgatgatatctggtttaccagccgca
ttagttgctcaggctttctctctatcaggtactcatttctgtatcgatgcggcttgttct
tctgctttctacgctatcaagttagcatctcattatctgtggacaggtaaggctgatgta
atgttagctggtgctattagttgctcagaccctttgtttttgcggatgttgttttctggg
attcaaggctatccagaaaatgggattagctctcctttagataaatcatccagaggctta
gttacatccgaaggcattggtatggtaatgctaaaacgatatagcgatgctgtgagggat
ggggataaaattctggctacagtttgtggtaatggtctttctaatgatgggaagggtaag
catttgctcagtcccaacacgaaagggcaagttacagcttttgagagagcctataaagaa
gcccaacttagccccaaagctatagattatatggagtgtcacgctaccggcactttgtta
ggagatacgacggaatttaattccatcgaaagcttttttggagaacatcaagccgcacca
ttaataggttcaagcaaagctaatgtaggtcacttgttagttgcggcggggatggtgagt
ttaacgaaggcgatttacggcatgaattatggtgtgattccacccacgattaatgtcaat
gaccctataggtactgaaaacaatgtcatttctccccaaaacattgttcggactcccaca
gcctggcctatcaataccggaactaaacacgcggctttaagtgctttcggttttggtggt
acaaactcccatctgattttggaaaaagcagcagatttgtag

DBGET integrated database retrieval system