KEGG   Trichormus variabilis: Ava_2940Help
Entry
Ava_2940          CDS       T00277                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ava  Trichormus variabilis
Brite
Enzymes [BR:ava01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Ava_2940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ubie_methyltran Methyltransf_31 Methyltransf_25 Methyltransf_11 PCMT Methyltransf_12 Methyltransf_23 PrmA Methyltr_RsmB-F MTS CMAS Methyltransf_4 Fibrillarin GCD14 FtsJ Methyltransf_18 UPF0020 NodS Methyltransf_3 Methyltransf_16 MetW Methyltransf_8
Motif
Other DBs
NCBI-ProteinID: ABA22551
JGI: Ava2940
CyanoBase: Ava_2940
CYORF: Ava_2940
UniProt: Q3M8Y5
Position
complement(3643725..3644537)
Genome map
AA seq 270 aa AA seqDB search
MDNREYEQKYKIDVINFFDSRTSYDNDYTIRRALPLLELIPLKTGQKVLDLATGTGIIAI
AAAEIVGSTGKVIGVDFSSGMLAQAEQKIKTLGWQNIELIKADAEYINFEDESFDVILCS
TAIVYFQDIPAALGKWYRFLKKGGIVGFSCCSQESCEAPTLIKACAENDILLVNINEPTG
TIEKCHHLMQAASFENIEVKTQQLGFYRSLEQAKRWNGGWFHPRENPLLNLSSAQMEKLQ
AEYCREIEAKATEQGVWYENLTFFVSGQKI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggataacagagaatacgagcaaaaatataagattgacgtaatcaactttttcgacagt
agaaccagttatgacaacgactatacaatccgtcgcgctttgcctttattagaactgatt
cccttaaaaactgggcagaaagtattggatttggcgacggggacgggtattattgcgatc
gctgctgctgaaattgttggttctactggcaaggtaattggcgtagatttttcttcagga
atgctggctcaagcggaacagaagattaaaacactagggtggcaaaatatcgaattaata
aaagcagatgccgaatacatcaactttgaagatgaaagttttgatgtcattctttgttct
accgcgatcgtctatttccaagatattccggctgctttaggtaagtggtatcggtttctc
aaaaaaggtggaatagtaggattttcttgctgttctcaagagtcatgcgaagcgccaact
ctgattaaagcttgtgcagaaaatgatattttactcgttaatatcaatgaaccaacaggt
actatcgaaaagtgtcatcatctcatgcaggcggctagttttgaaaatattgaggtgaaa
actcagcaacttggtttctaccgcagcctagagcaagctaaaagatggaatggcggatgg
ttccaccctagagaaaatcctttattgaatctgtcatcagcacagatggaaaagttgcaa
gcagaatattgtcgagaaattgaagcgaaagcgacagagcaaggtgtttggtacgaaaat
ttaacttttttcgtcagtggtcaaaaaatatag

DBGET integrated database retrieval system