KEGG   Anabaena variabilis: Ava_3044Help
Entry
Ava_3044          CDS       T00277                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ava  Anabaena variabilis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ava_3044 (pfkA)
   01230 Biosynthesis of amino acids
    Ava_3044 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ava_3044 (pfkA)
   00030 Pentose phosphate pathway
    Ava_3044 (pfkA)
   00051 Fructose and mannose metabolism
    Ava_3044 (pfkA)
   00052 Galactose metabolism
    Ava_3044 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Ava_3044 (pfkA)
Enzymes [BR:ava01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ava_3044 (pfkA)
Protein phosphatases and associated proteins [BR:ava01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ava_3044 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(3770800..3771873)
Genome map
AA seq 357 aa AA seqDB search
MRKKIGILTSGGDCPGLNCVIRAVVSHATLTYDWEVFGIPYATQGLLERQAIALNMHGWD
LRGIDPLLNMGGTILGTINKGDTLAHVDEMLASYEALALDALIVIGGDGSLGILHELASR
GNWNLVAIPKTIDSDVALTERAVGFDTAVNTIVDALNRLTFTAASHDRVMIVEVMGRSAG
HLALHAGIAGGADVILIPEISYTISGLCQYIAELRDRWQRKFAIVVVAEGAKLCLEDVQE
NIASACVSPKCGRGQYIAEQIARCSKNLIDTRVSVLGHIQRGGIPSALDRLTATVFGKTA
VDLVAQGKFGQMVAWQNGEAIPVPIQDVVAQSPLHVNPQGSLVQSARCLGIYVGEKT
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaaaattggtatcctcacaagtggtggtgactgtccagggcttaactgcgtg
attcgtgcagttgtcagccatgcaacacttacttatgattgggaagtatttggtatacct
tatgccactcagggtttactagagcgtcaagcgatcgctctgaatatgcacggctgggat
ttgcggggtattgaccctctgctaaatatgggtggcacgattttaggcactattaataag
ggtgacaccttagcgcacgtagatgagatgcttgccagttatgaggctttggctttggat
gctttgatcgtcattggtggtgatggtagtctgggcattctccatgaactagctagccga
ggtaattggaatttagtggcgattcccaaaactatagatagtgatgtggcgttgacagaa
cgcgctgtgggttttgatacggctgtcaatacaattgtcgatgccctcaatcgtttgacc
tttacggctgcaagtcacgatcgcgtgatgattgtcgaagttatgggacgcagtgccgga
catctagccctacacgcgggtattgccgggggtgcagatgtgattttaatccccgaaatt
tcatacacaattagtggtttatgtcaatacatagctgagttgcgcgatcgctggcaacgc
aaatttgcgatcgtcgttgttgctgaaggtgcgaaactatgtctggaagacgtgcaagaa
aatattgcctctgcttgtgtgtctcctaaatgcggtcgtggtcaatatattgcggagcaa
attgctcgatgcagtaaaaatctcatcgataccagagtttctgtattgggacacattcag
cgtggcggtatcccatcagctttagaccgtttaacagccacagtctttgggaaaacagcc
gttgatttagtagctcaaggtaaatttgggcagatggtagcctggcaaaatggcgaagct
atcccagtacccattcaagacgttgtagctcaaagtcctttacacgtaaatccccaaggt
tcgttggtacagagcgctcgttgtttgggtatttatgtaggagaaaaaacttaa

DBGET integrated database retrieval system