KEGG   Anabaena variabilis: Ava_3117Help
Entry
Ava_3117          CDS       T00277                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ava  Anabaena variabilis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ava_3117
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ava_3117
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ava_3117
Enzymes [BR:ava01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ava_3117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(3871399..3872490)
Genome map
AA seq 363 aa AA seqDB search
MTLSLSVAKSHRQPWPGLIEAYREYLPVSEQTPVVTLLEGNTPLIPVPAIAERIGRQVSV
FVKYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNTSAAAAAYARRGGMKAFVLI
PDGYVALGKLAQALLYGAEVLAIKGNFDRALEIVREMAETYPITLVNSVNPYRLEGQKTG
AFEVVDALGNAPDWLCIPVGNAGNITAYWMGFCQYHQAGKCDRLPQMMGFQAAGAAPLVN
GQPVSHPETIATAIRIGNPASWDKAIAAQSASQGSFNAVTDEEILDAYRLLASSEGIFCE
PASAASVAGLLKVKDQVPTGATVVCVLTGNGLKDPDTAIKHSHSQFKQGLEADLKDVAKA
MGF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgactttgagcttgtctgttgctaaatctcatcgccaaccctggcccggactgatagaa
gcctatcgtgagtacttacctgtcagtgaacaaacgccagttgtaactttgttggaaggt
aacactcctttaattccggtgccagcgatcgcagaacgtatcggtagacaagtaagtgtg
ttcgtgaaatacgatggtctcaaccccactggcagcttcaaggacagggggatgactatg
gcgatttccaaagcgaaggaagctggagccaaagcggttatttgtgcgagtacaggcaat
acctcagccgcagccgcagcctatgcccgtcgtggcggaatgaaggcttttgtactgatt
cccgatggttatgtggctttgggtaagctggcgcaagcacttctttatggtgcagaagta
ttggcaattaaaggcaactttgatagagccttagaaattgtccgcgagatggcggaaacc
tatcccatcaccctggtgaattcagtcaatccctatcgcttggaaggtcaaaaaacagga
gcctttgaggttgtcgatgctttgggtaatgccccagactggttgtgcatcccagttggt
aacgcgggaaatatcacagcatattggatgggtttttgtcaatatcatcaagcagggaaa
tgcgatcgcctaccccagatgatgggctttcaagccgcaggtgcagctcccttggtaaat
ggccagcctgtatcccatcccgaaaccatcgctaccgccattcgcatcggtaaccccgcg
agttgggataaagcgatcgccgcccaatcagccagtcaaggaagttttaacgccgttact
gatgaagaaattctcgacgcataccgattattggcatcatcagaaggcattttctgcgaa
cccgccagcgctgcttccgtcgccggcttattaaaagtcaaagaccaagtacccacaggc
gcaacagtagtatgtgtcctcacaggtaacggtcttaaagacccggacacagcaattaaa
cacagtcacagccaatttaaacaaggccttgaggcagatttaaaagatgtagccaaggca
atgggattttaa

DBGET integrated database retrieval system