KEGG   Anabaena variabilis: Ava_3117Help
Entry
Ava_3117          CDS       T00277                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ava  Anabaena variabilis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ava01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ava00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:ava00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(3871399..3872490)
Genome map
AA seq 363 aa AA seqDB search
MTLSLSVAKSHRQPWPGLIEAYREYLPVSEQTPVVTLLEGNTPLIPVPAIAERIGRQVSV
FVKYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNTSAAAAAYARRGGMKAFVLI
PDGYVALGKLAQALLYGAEVLAIKGNFDRALEIVREMAETYPITLVNSVNPYRLEGQKTG
AFEVVDALGNAPDWLCIPVGNAGNITAYWMGFCQYHQAGKCDRLPQMMGFQAAGAAPLVN
GQPVSHPETIATAIRIGNPASWDKAIAAQSASQGSFNAVTDEEILDAYRLLASSEGIFCE
PASAASVAGLLKVKDQVPTGATVVCVLTGNGLKDPDTAIKHSHSQFKQGLEADLKDVAKA
MGF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgactttgagcttgtctgttgctaaatctcatcgccaaccctggcccggactgatagaa
gcctatcgtgagtacttacctgtcagtgaacaaacgccagttgtaactttgttggaaggt
aacactcctttaattccggtgccagcgatcgcagaacgtatcggtagacaagtaagtgtg
ttcgtgaaatacgatggtctcaaccccactggcagcttcaaggacagggggatgactatg
gcgatttccaaagcgaaggaagctggagccaaagcggttatttgtgcgagtacaggcaat
acctcagccgcagccgcagcctatgcccgtcgtggcggaatgaaggcttttgtactgatt
cccgatggttatgtggctttgggtaagctggcgcaagcacttctttatggtgcagaagta
ttggcaattaaaggcaactttgatagagccttagaaattgtccgcgagatggcggaaacc
tatcccatcaccctggtgaattcagtcaatccctatcgcttggaaggtcaaaaaacagga
gcctttgaggttgtcgatgctttgggtaatgccccagactggttgtgcatcccagttggt
aacgcgggaaatatcacagcatattggatgggtttttgtcaatatcatcaagcagggaaa
tgcgatcgcctaccccagatgatgggctttcaagccgcaggtgcagctcccttggtaaat
ggccagcctgtatcccatcccgaaaccatcgctaccgccattcgcatcggtaaccccgcg
agttgggataaagcgatcgccgcccaatcagccagtcaaggaagttttaacgccgttact
gatgaagaaattctcgacgcataccgattattggcatcatcagaaggcattttctgcgaa
cccgccagcgctgcttccgtcgccggcttattaaaagtcaaagaccaagtacccacaggc
gcaacagtagtatgtgtcctcacaggtaacggtcttaaagacccggacacagcaattaaa
cacagtcacagccaatttaaacaaggccttgaggcagatttaaaagatgtagccaaggca
atgggattttaa

DBGET integrated database retrieval system