KEGG   Anabaena variabilis: Ava_3166Help
Entry
Ava_3166          CDS       T00277                                 

Definition
(GenBank) Response regulator receiver domain protein (CheY) (EC:3.1.1.61)
Organism
ava  Anabaena variabilis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
3932593..3933003
Genome map
AA seq 136 aa AA seqDB search
MFSCESSTLKVLVVDDHELTRLTLQLAFSSQENIQVVGLASNGQEAIEMVRDSHPDVIVL
DLQMPVMDGWSASCHIKAISPNTQILAYSSVEDIRFLDTKTTSNFDDVCKKDVPTKELIA
LVRELGRRGANSSISQ
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgttctcttgtgagtcctctaccttaaaggttctagtggttgacgatcatgaactgact
cgtttaaccttacaattagccttttctagtcaggaaaatatccaagtagtcggtttagcc
agtaacggtcaagaagcgatagaaatggtaagagacagtcatcctgatgtcattgttcta
gacttacaaatgccagtcatggatggttggagcgcctcttgtcatattaaagccatttct
cccaacacacaaatactagcttattcgtcagtagaagatatacgttttcttgacacaaag
acaacttctaactttgatgatgtttgtaaaaaagatgtgcctaccaaggaacttattgct
ttggtaagagaattgggaagacgtggggcgaatagttcaatttcccaataa

DBGET integrated database retrieval system