KEGG   Anabaena variabilis: Ava_3166Help
Entry
Ava_3166          CDS       T00277                                 

Definition
response regulator receiver domain-containing protein (EC:3.1.1.61)
Orthology
K05971  
[EC:3.1.1.61]
Organism
ava  Anabaena variabilis
Brite
Enzymes [BR:ava01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Ava_3166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
3932593..3933003
Genome map
AA seq 136 aa AA seqDB search
MFSCESSTLKVLVVDDHELTRLTLQLAFSSQENIQVVGLASNGQEAIEMVRDSHPDVIVL
DLQMPVMDGWSASCHIKAISPNTQILAYSSVEDIRFLDTKTTSNFDDVCKKDVPTKELIA
LVRELGRRGANSSISQ
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgttctcttgtgagtcctctaccttaaaggttctagtggttgacgatcatgaactgact
cgtttaaccttacaattagccttttctagtcaggaaaatatccaagtagtcggtttagcc
agtaacggtcaagaagcgatagaaatggtaagagacagtcatcctgatgtcattgttcta
gacttacaaatgccagtcatggatggttggagcgcctcttgtcatattaaagccatttct
cccaacacacaaatactagcttattcgtcagtagaagatatacgttttcttgacacaaag
acaacttctaactttgatgatgtttgtaaaaaagatgtgcctaccaaggaacttattgct
ttggtaagagaattgggaagacgtggggcgaatagttcaatttcccaataa

DBGET integrated database retrieval system