KEGG   Anabaena variabilis: Ava_3290Help
Entry
Ava_3290          CDS       T00277                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ava  Anabaena variabilis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ava_3290 (tpiA)
   01230 Biosynthesis of amino acids
    Ava_3290 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ava_3290 (tpiA)
   00051 Fructose and mannose metabolism
    Ava_3290 (tpiA)
   00562 Inositol phosphate metabolism
    Ava_3290 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Ava_3290 (tpiA)
Enzymes [BR:ava01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ava_3290 (tpiA)
Exosome [BR:ava04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ava_3290 (tpiA)
  Exosomal proteins of bladder cancer cells
   Ava_3290 (tpiA)
  Exosomal proteins of melanoma cells
   Ava_3290 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(4104387..4105112)
Genome map
AA seq 241 aa AA seqDB search
MRKIVIAGNWKMFKTQAESQEFLKEFLPALEETPQEREVLLCVPFTDLAILSQSLHGSLV
QLGAQNVHWAENGAYTGEISGPMLTEIGVRYVIVGHSERRQFFGETDETVNLRLQAAQKY
GLTPILCVGETKQQRDSGETESLIVSQLDKDLINVDQTNLVIAYEPIWAIGTGDTCETTE
ANRVIGLIRSQLKNPDVPIQYGGSVKPNNIDEIMAQPEIDGVLVGGASLEAASFARIVNY
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgcggaaaatagttattgccggtaactggaaaatgttcaaaacccaggcagagtctcaa
gagttcttaaaagaatttctgcctgcattagaggaaacacctcaagaacgggaagtgctg
ctttgcgttcctttcactgatctggccattttgtctcagagtctacatggtagccttgta
caactcggagcgcaaaacgtccactgggcagaaaatggagcctacactggtgaaatttct
ggcccaatgttgacagaaattggtgtccgttacgtcattgtcggtcatagtgaacgacga
caattttttggggaaacagacgagacagttaatttacgtctccaagctgctcaaaagtat
gggttaacgccgattctttgtgtaggcgaaaccaaacaacagcgagattctggagaaact
gaatcactaattgtcagccaactagacaaagacctcataaatgtcgatcagacgaatttg
gtaattgcttatgaaccaatttgggcaattggtactggtgacacttgtgaaacaacagag
gctaatcgagttattggcttaattcgtagccaattgaagaatcctgatgtgccgattcaa
tatggtggctcagtcaaaccaaataatattgacgagattatggctcaaccagaaattgat
ggcgttctcgtgggcggagcaagtctagaagctgcaagtttcgcccgaattgtgaactat
cagtaa

DBGET integrated database retrieval system