KEGG   Anabaena variabilis: Ava_3643Help
Entry
Ava_3643          CDS       T00277                                 

Definition
Na-Ca exchanger/integrin-beta4 (EC:3.4.24.40)
Orthology
K01406  
serralysin [EC:3.4.24.40]
Organism
ava  Anabaena variabilis
Brite
Enzymes [BR:ava01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.40  serralysin
     Ava_3643
Peptidases [BR:ava01002]
 Metallo Peptidases
  Family M10
   Ava_3643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4543785..4547327
Genome map
AA seq 1180 aa AA seqDB search
MDPISGTNGNDNLSGTSGDDIIQGFNGNDTLSGLGGNDRLEGGRGDDTLTGGAGNDVFNF
EQLQDNDVVTDFVRGQDKIDVRNLNINDWATLQLLISNDGQDNALITTFSSGSQSRIKLL
NINPNLLQASDFIFNTVNLNQTIEGTNFADQLFGGLGNDTLRGFNGNDVLFGEQGDDRFE
GGRGDDTFYGGAGNDVFNLEQLQDNDVVIDFVRGQDKIDVRNLNINDWATLQLLISNDGQ
DNALITTFSSGSQSQIKLLNINPNLLQASDFIFNTVNLNQTIDGTNFADQLFGGLGNDTL
RGFNGNDVLFGEQGDDRFEGGRGDDTFYGGAGNDVFNLEQLQDNDVVIDFVRGQDKIDVR
NLNINDWTTLQLLISNDGQDNALITTFFNGSQSRIKLLNINPNLLQASDFIFNTVNLNQT
IEGTNFADQLFGGLGNDTLRGFNGNDVLFGEQGDDRFEGGRGDDTFYSGAGNDVFNLEQL
QDNDVVIDFVRGQDKIDLRSLNISDWSTLQTLISNDGQNNALITTFFNGSQSQIKLNNIN
PNLLQASDFIFNTNTVNNNETIDGTNFADQLFGGLGNDTLRGFNGNDVLFGEQGDDRFEG
GAGNDTFYGGAGNDIAVYSGTRSQYQVTSSGGVFTVTDTVANRDGVDTLREVEQIQFSDQ
TITIGNTSPTITLAVSPASVTEDGTPNLIYTFTRTGSTTNALTVNYSVAGTATLNTDYAQ
SGATSFTATTGTITFAAGASTAILTINPTADTTVESNETVALTLATGTGYTVGTTTAVTG
TITNDDTSPTGITINLSGSQTIVEGSTSPQNVTYTVTLSQASSQIITVQYATANGTATAG
SDYTSTTGTLTFNPGETSKVINIPILNDSVNEANETFTLRLTSPTNATLGTTNTVTTTIT
DTLSASVTTTLPTNVENLTLTGTAAINGTGNAGNNVLTGNSGNNILSGGAGNDTYAFVAN
AALGTDTITETATGGIDTIDFSGSTGAVRVNLGVTTSQTVNSNLKLILSANNVIENATGG
TGNDRLTGNALNNILAGGNGNDQLQGLAGNDTLWGGLGDDILTGGAGQDKYLFQSSGVFS
SSLGVDYISQFDVGQDQIVLSKATFNAVTNSAGQALTDFAVVSDDEFVNASSARIVYSQG
SGSLFYNRDGNVLGTGTVFEFARLGNPDITLSSSDFSLIA
NT seq 3543 nt NT seq  +upstreamnt  +downstreamnt
atggatcctatttcaggaacaaacggcaacgataatttaagcggcacttctggcgacgat
attattcaaggcttcaatggtaatgatacactttctggactaggtggaaatgaccgtttg
gaaggtggtcggggtgatgataccttaaccggtggcgctggtaatgatgtctttaacttt
gaacagttgcaagacaatgatgtagttacagattttgtgcgtggacaagacaaaatagat
gtcagaaacctgaatattaatgattgggctaccctacaattactcattagtaatgatggt
caagacaatgccttaattactactttttctagtggttctcagtcgcgaatcaaactactg
aatatcaatccaaacctactacaagctagtgatttcatcttcaacaccgttaacctgaat
caaactatcgagggtactaacttcgcagatcagttattcggtggtttaggtaatgatacc
ctcagaggatttaatggtaatgatgtcttatttggtgaacagggtgatgaccgttttgaa
ggtggtcggggtgatgatactttctatggtggtgctggtaatgatgtctttaacttggaa
cagctacaagacaatgatgtagtcatagattttgtacgtggacaagacaaaatagatgtc
agaaacctgaatattaatgattgggctaccctacaattactcattagtaatgatggtcaa
gacaatgccttaattactactttttctagtggttctcagtcacaaattaaactactgaat
attaatccaaacctactccaagctagtgatttcatcttcaacaccgttaacctcaatcaa
actatcgatggtactaactttgcagatcagttattcggtggtttaggtaatgataccctc
agaggatttaatggtaatgatgtcttatttggtgaacagggtgatgaccgttttgaaggt
ggtcggggtgatgatactttctatggtggtgctggtaatgatgtctttaacttggaacag
ctacaagacaatgatgtagtcatagattttgtacgtggacaagacaaaatagatgtcaga
aacctgaatattaatgattggactaccctgcaattactcattagtaatgatggtcaagac
aatgccttaattactaccttcttcaatggttctcagtcgcgaatcaaactactgaatatc
aacccaaacctactccaagctagtgatttcatcttcaacaccgttaacctcaatcaaact
atcgagggtactaacttcgcagatcagttattcggtggtttaggtaatgataccctcaga
ggatttaatggtaatgatgtcttatttggtgaacagggtgatgaccgttttgaaggtggt
cggggtgatgatactttctatagtggtgctggtaatgatgtctttaacttggaacagcta
caagacaatgatgtagtcatagattttgtacgtggacaagacaagattgacctcagaagc
ctcaatattagtgattggtcaacattacaaacactcattagtaatgatggtcagaataat
gccttaattactaccttcttcaatggttctcaatcacaaatcaaactcaataacattaat
cccaatctactacaagctagtgatttcatcttcaacactaatactgttaacaacaatgaa
actatcgatggtactaacttcgcagatcagttattcggtggtttaggtaatgataccctc
agaggatttaatggtaatgatgtcttatttggtgaacaaggtgacgaccgttttgaaggt
ggtgctggtaatgacacattctatggtggcgctggtaatgatatcgccgtttactcaggt
actcgttctcaatatcaagtaaccagtagtggaggtgtttttacagttaccgatacagtg
gctaatcgtgatggcgtagatacattacgtgaagttgaacaaatacaattttcagatcaa
actataaccattggtaatacctctccaactatcaccctagccgtatctccagctagcgtt
accgaagacggaaccccaaatctaatttacactttcacccgcactggcagcactaccaac
gccttaactgttaactatagcgttgctgggacagctaccctcaacactgactatgctcaa
agtggcgctactagtttcactgctaccacgggtaccattacctttgcggcgggtgcaagt
acagccatcttaacgattaatcctaccgcagataccaccgtcgaaagtaacgaaaccgtt
gctttaactttagcaaccggcacaggttatacagtcgggacaacaacagccgtcactgga
accattactaatgatgatacctcacctactggcattactatcaatctcagtggtagtcaa
accatagtcgaaggtagtaccagtcctcaaaacgttacatataccgttactctttcccaa
gccagcagtcaaattatcaccgtgcaatatgccaccgctaatggtacagctacagcaggt
tcggactatacaagcacaacaggaactctgactttcaacccaggggaaaccagtaaagtc
atcaatatccccattctcaatgattcagttaatgaggcaaatgaaacctttacgctgagg
ttgacttctcccaccaatgctactcttgggacaaccaatactgttaccacaactatcacc
gataccctcagtgcttctgtgactaccactttgccaaccaatgtggaaaacctcaccctc
acaggaacagcagcaattaacggtacaggtaatgccggaaataatgtccttactggtaat
agtggcaataatattctttctggtggcgctggaaacgatacttatgcctttgtagctaat
gctgccttgggaacggacaccattacagaaaccgctacaggtggtattgacactattgac
ttcagtggtagtacgggtgctgtcagggtgaatttgggtgtgactacatcacaaacggtg
aatagcaacctcaaactgattctctctgctaataacgtcatcgaaaatgctacaggtggt
acaggtaatgacaggctcactggtaatgctttaaataatattctggctggtggtaacgga
aacgaccaactgcaaggattagctggaaatgataccctctggggtggattgggggatgat
attctgactggtggcgctggtcaggataaatatctattccaaagtagtggtgtttttagt
tccagcttaggggttgattacattagccagtttgatgtgggacaagaccaaattgtgttg
agtaaagctacatttaatgctgttactaatagcgcaggacaggctttaactgattttgcc
gttgtcagtgatgatgaatttgttaatgctagtagtgcgcggattgtctatagccaaggt
agtggtagcttattctacaatcgagacggtaatgttctgggtacaggtacagtgtttgag
tttgctcgtttaggtaatcctgatattactttaagtagtagcgattttagtttaattgcc
tag

DBGET integrated database retrieval system