KEGG   Anabaena variabilis: Ava_3755Help
Entry
Ava_3755          CDS       T00277                                 

Gene name
tgt
Definition
queuine tRNA-ribosyltransferase (EC:2.4.2.29)
Orthology
K00773  
queuine tRNA-ribosyltransferase [EC:2.4.2.29]
Organism
ava  Anabaena variabilis
Brite
Enzymes [BR:ava01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.29  tRNA-guanosine34 transglycosylase
     Ava_3755 (tgt)
Transfer RNA biogenesis [BR:ava03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Ava_3755 (tgt)
 Prokaryotic Type
    Ava_3755 (tgt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4675839..4677002
Genome map
AA seq 387 aa AA seqDB search
MSIYLNKLNLTLSAIFSFQSLARCSQTKARAGVFLTPHGVVETPRFMPVGTLANVKTVTP
AQLKETGAQMVLSNTYHLHLQPGEAIVAGGGGLHKFMGWNGPMLTDSGGFQVFSLSEMRK
ITEEGVTFRSPHDGQIIKLTPERSIEIQNILGADVIMAFDECPPYPATRQEVEAATERTY
RWLERCITAHQRQDQALFGIVQGGVYLDLRAKAANTLTELDLPGYAIGGVSVGEPPEMMA
QIVQATAPLLPAHKPRYLMGVGTYREMVIAIASGIDLFDCVIPTRWARHGTAMVKGERWN
LKNAKFREDFAPIDETCPCYACQNFSRAYISHLVRSQEILAYTLLSIHNITELIRFTQKI
REAILSDRFLEEFGHWLNSPETEVDNG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
ttgtccatatacttaaacaagctgaatcttaccttgagtgctatattttcttttcaatcc
ctagctcgttgtagccaaacaaaagccagagcaggggtatttttaactccccacggtgtt
gtagaaactccgagatttatgccggtgggaaccctggccaatgtaaagactgtcacccca
gcccaactgaaggagactggggcgcagatggttctttctaatacttatcatctccatctc
caaccaggggaagccattgtggctggtggtggtggattgcataaatttatgggctggaat
gggccgatgctcaccgattctggtgggtttcaggttttcagcttgagcgaaatgagaaaa
attacggaagagggtgtaacttttcgctcaccccacgacgggcaaattattaaattaacg
ccggaacgctctatagagattcaaaatattttaggggctgatgttatcatggcgttcgat
gaatgtcccccctacccagcgactcgccaggaagtagaagcggcgactgagcggacttat
cgttggttggaacgttgtattacggcgcatcaacgccaggatcaagcgttgtttggtatt
gttcaaggtggggtatatctggatttacgggctaaagctgccaatactttaactgagcta
gatttacctggttatgccattggtggggtgagtgtgggggaaccaccagaaatgatggcg
caaattgtccaagctacagcaccactgttaccagcacacaagccccgctacttgatgggt
gtgggaacttatcgagaaatggtaattgcgatcgcctctggtatagacttatttgattgc
gtcattcccacccgttgggcgagacacggtacagcaatggtaaaaggcgaacgttggaac
ttaaaaaatgctaagttccgtgaagattttgcccccatagatgaaacttgcccttgttat
gcttgtcaaaatttcagccgtgcctatatttctcatttagtgcgatcgcaagaaatttta
gcctacactttactgagcattcacaatattaccgaactcattcgctttacccaaaaaatt
cgtgaagcaatattaagcgatcgttttttggaagaatttggtcactggttaaactcgccg
gaaactgaagttgataatgggtaa

DBGET integrated database retrieval system