KEGG   Anabaena variabilis: Ava_3763Help
Entry
Ava_3763          CDS       T00277                                 

Definition
thioredoxin (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
ava  Anabaena variabilis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(4684150..4684467)
Genome map
AA seq 105 aa AA seqDB search
MTEKKQFNSFEEMLSGSDLPVLVDFYADWCGPCQMMATILQQVNNQLKDRIRIVKIDTEK
YTELATQYQIYALPTLVLFKQGKPVDRIEGVLQTPDLVQRLQSFV
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaaaaaacagttcaacagctttgaagagatgctatctggttctgatttacct
gttttagtagacttttatgctgactggtgtggcccctgtcagatgatggcgacaatttta
caacaagtaaacaatcaacttaaagaccgcatacgaattgtcaaaattgacacggaaaaa
tacacagagttagcaactcagtatcaaatctacgctctaccaacactagtattgttcaaa
caaggtaaaccagttgatcgaattgaaggtgtattgcaaacgcccgatttagtacagcgt
ctgcaaagttttgtttag

DBGET integrated database retrieval system