KEGG   Trichormus variabilis: Ava_3763Help
Entry
Ava_3763          CDS       T00277                                 

Definition
(GenBank) Thioredoxin
  KO
K01829  protein disulfide-isomerase [EC:5.3.4.1]
Organism
ava  Trichormus variabilis
Brite
Enzymes [BR:ava01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Ava_3763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 TraF AhpC-TSA HyaE Thioredoxin_9 Thioredoxin_6 KaiB DIM1 DUF836
Motif
Other DBs
NCBI-ProteinID: ABA23368
JGI: Ava3763
CyanoBase: Ava_3763
CYORF: Ava_3763
UniProt: Q3M6L8
Position
complement(4684150..4684467)
Genome map
AA seq 105 aa AA seqDB search
MTEKKQFNSFEEMLSGSDLPVLVDFYADWCGPCQMMATILQQVNNQLKDRIRIVKIDTEK
YTELATQYQIYALPTLVLFKQGKPVDRIEGVLQTPDLVQRLQSFV
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaaaaaacagttcaacagctttgaagagatgctatctggttctgatttacct
gttttagtagacttttatgctgactggtgtggcccctgtcagatgatggcgacaatttta
caacaagtaaacaatcaacttaaagaccgcatacgaattgtcaaaattgacacggaaaaa
tacacagagttagcaactcagtatcaaatctacgctctaccaacactagtattgttcaaa
caaggtaaaccagttgatcgaattgaaggtgtattgcaaacgcccgatttagtacagcgt
ctgcaaagttttgtttag

DBGET integrated database retrieval system