KEGG   Trichormus variabilis: Ava_3807Help
Entry
Ava_3807          CDS       T00277                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ava  Trichormus variabilis
Pathway
ava00330  Arginine and proline metabolism
ava00332  Carbapenem biosynthesis
ava01100  Metabolic pathways
ava01130  Biosynthesis of antibiotics
ava01230  Biosynthesis of amino acids
Module
ava_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Ava_3807
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Ava_3807
Enzymes [BR:ava01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Ava_3807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA SelB-wing_1
Motif
Other DBs
NCBI-ProteinID: ABA23412
JGI: Ava3807
CyanoBase: Ava_3807
CYORF: Ava_3807
UniProt: Q3M6H4
Position
4741088..4742197
Genome map
AA seq 369 aa AA seqDB search
MTKTIVVKIGTSSLTQPETGQLALSTIATLAETLSYLRQQGNQVILVSSGAVGVGCARLG
LTERPKAIALKQAVAAVGQGRLMRVYDDLFTTLQQPIAQVLLTRSDLVQRSRYLNVYNTF
RELLALGVIPVVNENDTVAVDELKFGDNDTLSALVASLVEADWLFLLTDVDRLYSADPRS
VPDARPISLVTSIKELADLQVQTGSQGSQWGTGGMMTKISAARIAIAAGVRTVITQGRYP
RNIEKIIQGELIGTHFQPQPEPTSARKRWIAYGLVPTGKLYLDSGAIAAIVKAGKSLLPA
GVKTVAGEFEPQDAVQLLDPQGNEIARGLVNYSSKDLQQICGRHSKEISTILGYVGAETV
IHRDNLVLT
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaacaattgtcgtcaaaatcggcacatctagcctcacccaaccagaaaccgga
caactagccctctccaccattgcaactttggcggaaacactctcttatttaagacagcaa
ggtaatcaagtgattttagtctcctctggggctgtgggagtcggttgtgcgcggttgggt
ttaacggaacgtcccaaagcgatcgctctcaaacaagcagtagccgcagtgggtcaaggt
agattaatgcgcgtatatgacgacttatttaccaccttacaacagccgatcgcccaagtt
ttgctaactcgcagcgatttggtacaacgtagccgttatctcaacgtatacaacaccttt
cgggaattacttgccttgggggtaattcctgtagtcaacgagaatgataccgttgccgtg
gatgaactgaaatttggtgataatgataccctttcagctttggttgctagtcttgtagag
gcagactggctatttttactcactgacgtagaccgattatactcagccgatccccgttct
gtccccgatgcccgaccgatatctttggtgacaagcatcaaagaattagcagacttacaa
gtacaaacaggttctcaaggttctcaatggggtactgggggaatgatgacaaaaatttcg
gcggcgagaattgcgatcgcggcgggagtgcgtactgtgattactcaagggcgatatcct
cgcaatatcgaaaaaattatccaaggggaactgattggaactcattttcaaccccaacca
gaaccaacctccgcccgtaaacgttggattgcttacggtttagtcccgacaggtaaatta
tacttagattctggtgcgatcgccgccatagttaaagcaggtaaatcgttattgccagca
ggagttaaaaccgttgcaggtgaatttgagcctcaagatgcagtacagctattagatcct
caaggtaacgaaattgccagaggactagttaactatagcagcaaagacttacagcaaatt
tgtggtcgtcactctaaagaaatttcgactattttgggttatgtaggtgcagaaaccgtg
atccatcgagataacttagtattgacgtag

DBGET integrated database retrieval system