KEGG   Anabaena variabilis: Ava_3828Help
Entry
Ava_3828          CDS       T00277                                 

Definition
(GenBank) coproporphyrinogen III oxidase, anaerobic (EC:1.3.99.22)
  KO
K02495  
oxygen-independent coproporphyrinogen III oxidase [EC:1.3.99.22]
Organism
ava  Anabaena variabilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ava_3828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4764292..4765674
Genome map
AA seq 460 aa AA seqDB search
MVFVLPGVKFDLDMIKKYDTPAPRYTSYPPATQLTEEFSATDYQSAIAASNHRKSPISLY
FHIPFCQSSCYFCGCNTVISNNKNIAKPYLEHLVKEIKHTSNLIDPDRKVLQVHWGGGTP
NYLDCDQVEFLWKHIHRHFNIDPQAEISIEINPRYVDQNYISFLREIGFNRISFGIQDFN
SQVQKAVNRIQPEELLVNVMSWIKAAKFDSVNVDLIYGLPHQTLQTFRETVKKTVALDPD
RIVVFNFAYVPWLKPAQKNIPLEALPQPQEKLEILKMTIEELTNSQYLFIGMDHFAKHND
ELAIAQRNHTLQRNFQGYTTHAGTELFGFGATSISMLHDAYVQNHKQLKEYYQAVAGDAL
PVSKGIKLTTDDILRRDVIMCIMSNFYLHKQEIEEKYQINFDEYFSQEIAALKPLAADGL
VSLSSKHIQVTEIGRLLVRNIAVVFDIYHHNQDKQFSRTI
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggtttttgtcttacctggtgtcaagtttgatctagacatgatcaaaaaatatgacact
cctgcacctagatataccagttatccacccgctacacagttaactgaagaatttagcgcc
accgattatcaaagtgcgatcgccgcctcaaatcacagaaaatcgcccatatcgttgtat
ttccacattcctttttgtcaaagttcctgttacttttgcggttgtaatacggttatttcc
aacaacaaaaatattgctaaaccatacttagaacatctggtaaaagaaatcaagcataca
agtaacttgattgatccagacagaaaagtattacaagttcactggggtggtgggacaccg
aattacttagattgtgatcaagtagaatttttgtggaaacatattcatcgccacttcaat
attgatccacaggcagaaatatccattgagattaatccccgctacgttgatcaaaactac
atctcctttttgcgtgagattggttttaaccggattagttttggcattcaggattttaat
agccaagtacaaaaagctgtcaaccgtatccaaccggaagaattgctagttaatgtcatg
agttggattaaagccgctaagtttgacagtgtaaatgtagacctaatttatggtttacct
catcaaaccttgcaaacatttcgggagacggtgaaaaaaaccgtggcattagaccccgat
cgcattgtagtctttaactttgcttatgttccttggttgaagccagcccagaaaaatatt
cccttggaggcgttaccccaaccgcaggaaaagctggaaattttaaaaatgactattgag
gaactgactaatagccagtacctatttattgggatggatcattttgccaagcataacgat
gagttagcgatcgcccaacgtaaccacaccctccagcgcaacttccagggctacaccacc
catgcaggtacagaactttttggctttggtgcgacatctattagtatgctgcatgatgct
tatgtgcagaatcacaagcagttaaaagaatattatcaagctgttgctggtgatgcttta
cctgtgagcaaaggtatcaaactcacaaccgatgatattctcagacgggatgtgattatg
tgtatcatgtctaacttttatctgcataagcaagagattgaggagaaatatcagatcaat
tttgatgaatatttctctcaagaaattgcagctttaaaaccattagcggctgatggatta
gttagtctctctagcaaacacattcaagtaacagaaatcggtagattactcgtgaggaat
atcgctgttgtctttgatatttatcaccacaatcaagacaagcaattctctcgtactatt
taa

DBGET integrated database retrieval system