KEGG   Anabaena variabilis: Ava_3851Help
Entry
Ava_3851          CDS       T00277                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
Organism
ava  Anabaena variabilis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4793543..4794226
Genome map
AA seq 227 aa AA seqDB search
MASNPVKILLVEDDELFRLGLRVRLQQEAGLEIIAEAEDGETALDLIKQNSLDVVLLDVG
LPGLGGIEACKQIKQQNPQLPILVLTSHSQKPLISKLIEAGAQGYCLKGIIAEKLVLALR
SVAAGASWWDETATREIRSSIESSQSQSPEQNFTKSDHPLTGRELEILSLLAKGKTNQEI
ATALYITPGTVRVHVHAILHKLEVSDRHQAVVVALQKRLIQNSAIAD
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcttctaacccggtaaaaattctgttggttgaagatgatgaactctttcgcttaggc
ttgcgcgtgcgattacaacaagaagcaggtttagaaattattgctgaggctgaagatggt
gaaacagctcttgatttaatcaagcaaaactctctggatgtggtgttattagatgtagga
ttaccagggctggggggaatagaagcttgtaaacaaattaagcagcaaaatcctcaatta
ccaattttagttttgacttcccattcccaaaaaccgttaatttctaaattaattgaagca
ggcgctcaaggatattgtctcaaaggaattatcgccgaaaaattagtattggcactgcgt
tctgtagcggctggggcttcttggtgggatgaaactgcaactagggaaattcgctcttca
attgagtctagccagtctcaatcgccagaacaaaatttcacaaaatctgatcacccttta
actggacgtgaattagaaattttatctttattagccaagggtaaaacgaatcaggaaatt
gctacagcactctacattacccctggaacagttagagttcatgttcatgctattctacac
aaactagaggttagcgatcgccatcaagctgtagttgttgctttacaaaaacgtttgatt
caaaatagtgcgatcgcagattaa

DBGET integrated database retrieval system