KEGG   Trichormus variabilis: Ava_3921Help
Entry
Ava_3921          CDS       T00277                                 

Definition
(GenBank) Cytochrome P450
  KO
K00493  unspecific monooxygenase [EC:1.14.14.1]
Organism
ava  Trichormus variabilis
Pathway
ava00071  Fatty acid degradation
ava00380  Tryptophan metabolism
ava00627  Aminobenzoate degradation
ava01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Ava_3921
  Amino acid metabolism
   00380 Tryptophan metabolism
    Ava_3921
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Ava_3921
Enzymes [BR:ava01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Ava_3921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450 DUF3843
Motif
Other DBs
NCBI-ProteinID: ABA23526
JGI: Ava3921
CyanoBase: Ava_3921
CYORF: Ava_3921
UniProt: Q59163
Position
complement(4874842..4876221)
Genome map
AA seq 459 aa AA seqDB search
MLTQLPNPISVPSWWQLINWIADPIGFQKKYSQKYGDIFSMQLAGIGSFVILGEPQAIQE
IFTQDSRFDIGRGNKLAEPLIGRTSLMLMDGDRHRRERKLLMPPFHGEKLQAYAQQICLI
THQIASQWQIGQPFVARSAMQKLSLEVIIQIVFGLANGERYQQIKPLFTDWLNMTDSPLR
SSMLFLKSLQQDWGNRSPWGQMKYQQRCIYDLLQAEIEEKRTKENERRGDVLSLMMAARD
ENGQAMTDEELKDELLTILFAGHETTATTIAWAFYQIFRNVNVREKLQQELDSLGENPNP
MEIAQLPYLTAVCQETLRMYPVLPTLFPRITKSSINIAGYQLEPNTTLMASIYLIHYRED
LYPHPQQFRPERFIERQYSPSEYIPFGGGSRRCLGYALALLEIKLVIATVLSNYQLALAE
DKPIKVQRRGFTLAPEGGVRMIMTGKKSLRFEQSNKIFN
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgttgactcaattaccaaatcctattagtgtcccttcatggtggcaactgatcaattgg
attgctgatccgattggatttcaaaaaaaatatagtcaaaagtatggcgacattttttcc
atgcagctggctggaatcggctctttcgtaattttaggcgagcctcaagctattcaagaa
atcttcacccaagattctagatttgatatcggtcggggaaataaacttgcagagcctctc
attggaagaacctctcttatgttaatggatggcgatcgccaccgacgagaacgaaaatta
ttaatgcccccctttcatggagaaaagctacaagcttatgctcaacaaatctgcttaatt
acccaccaaatcgccagccaatggcaaattgggcaaccttttgtggctaggtctgccatg
cagaaactgagtctagaggtaattatacaaatcgtctttggtttagctaacggagaacgc
tatcaacaaatcaagcctctattcacagattggctgaatatgactgattctcccttacgc
tccagtatgctatttttaaaatccctccaacaagattggggaaacaggagtccttgggga
caaatgaaataccaacaacgttgtatttatgatttactccaagcagaaatagaagagaaa
agaacaaaggaaaacgagaggcggggtgatgttctgagtttgatgatggcagcacgagat
gaaaatgggcaagccatgactgacgaagaactaaaagatgaattgctaaccattttattc
gctggacatgaaactactgcaacaacaatagcctgggctttctatcaaattttccgcaat
gtaaacgtgcgggaaaaattacagcaagaactcgacagcttgggagaaaatcctaaccca
atggaaattgcccagcttccttacttaacagcagtttgtcaagaaaccctgcggatgtat
ccagtcttaccaacgcttttcccacgcattaccaaatcatctataaatattgccggatac
cagttagaacccaacacaaccttaatggcgagtatctacctcatacattaccgagaagac
ttgtatcctcatcctcaacaatttcgaccagaacgttttatagaacggcaatattcccct
tcagaatatattccttttggtggtggaagtcgtcggtgtttgggatatgctctagctcta
ttagaaataaaattggttattgcaacagttttatcaaattatcaacttgctctagccgaa
gataaacctattaaagtgcaacgacgtggatttacccttgccccagagggtggagttagg
atgataatgactggtaaaaaatcattgagatttgagcaaagtaacaagatttttaattga

DBGET integrated database retrieval system