KEGG   Anabaena variabilis: Ava_3921Help
Entry
Ava_3921          CDS       T00277                                 

Definition
cytochrome P450 (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
ava  Anabaena variabilis
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Ava_3921
  Amino acid metabolism
   00380 Tryptophan metabolism
    Ava_3921
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Ava_3921
Enzymes [BR:ava01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Ava_3921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(4874842..4876221)
Genome map
AA seq 459 aa AA seqDB search
MLTQLPNPISVPSWWQLINWIADPIGFQKKYSQKYGDIFSMQLAGIGSFVILGEPQAIQE
IFTQDSRFDIGRGNKLAEPLIGRTSLMLMDGDRHRRERKLLMPPFHGEKLQAYAQQICLI
THQIASQWQIGQPFVARSAMQKLSLEVIIQIVFGLANGERYQQIKPLFTDWLNMTDSPLR
SSMLFLKSLQQDWGNRSPWGQMKYQQRCIYDLLQAEIEEKRTKENERRGDVLSLMMAARD
ENGQAMTDEELKDELLTILFAGHETTATTIAWAFYQIFRNVNVREKLQQELDSLGENPNP
MEIAQLPYLTAVCQETLRMYPVLPTLFPRITKSSINIAGYQLEPNTTLMASIYLIHYRED
LYPHPQQFRPERFIERQYSPSEYIPFGGGSRRCLGYALALLEIKLVIATVLSNYQLALAE
DKPIKVQRRGFTLAPEGGVRMIMTGKKSLRFEQSNKIFN
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgttgactcaattaccaaatcctattagtgtcccttcatggtggcaactgatcaattgg
attgctgatccgattggatttcaaaaaaaatatagtcaaaagtatggcgacattttttcc
atgcagctggctggaatcggctctttcgtaattttaggcgagcctcaagctattcaagaa
atcttcacccaagattctagatttgatatcggtcggggaaataaacttgcagagcctctc
attggaagaacctctcttatgttaatggatggcgatcgccaccgacgagaacgaaaatta
ttaatgcccccctttcatggagaaaagctacaagcttatgctcaacaaatctgcttaatt
acccaccaaatcgccagccaatggcaaattgggcaaccttttgtggctaggtctgccatg
cagaaactgagtctagaggtaattatacaaatcgtctttggtttagctaacggagaacgc
tatcaacaaatcaagcctctattcacagattggctgaatatgactgattctcccttacgc
tccagtatgctatttttaaaatccctccaacaagattggggaaacaggagtccttgggga
caaatgaaataccaacaacgttgtatttatgatttactccaagcagaaatagaagagaaa
agaacaaaggaaaacgagaggcggggtgatgttctgagtttgatgatggcagcacgagat
gaaaatgggcaagccatgactgacgaagaactaaaagatgaattgctaaccattttattc
gctggacatgaaactactgcaacaacaatagcctgggctttctatcaaattttccgcaat
gtaaacgtgcgggaaaaattacagcaagaactcgacagcttgggagaaaatcctaaccca
atggaaattgcccagcttccttacttaacagcagtttgtcaagaaaccctgcggatgtat
ccagtcttaccaacgcttttcccacgcattaccaaatcatctataaatattgccggatac
cagttagaacccaacacaaccttaatggcgagtatctacctcatacattaccgagaagac
ttgtatcctcatcctcaacaatttcgaccagaacgttttatagaacggcaatattcccct
tcagaatatattccttttggtggtggaagtcgtcggtgtttgggatatgctctagctcta
ttagaaataaaattggttattgcaacagttttatcaaattatcaacttgctctagccgaa
gataaacctattaaagtgcaacgacgtggatttacccttgccccagagggtggagttagg
atgataatgactggtaaaaaatcattgagatttgagcaaagtaacaagatttttaattga

  All links  
No link information was found.   
DBGET integrated database retrieval system