KEGG   Trichormus variabilis: Ava_3976Help
Entry
Ava_3976          CDS       T00277                                 

Definition
(GenBank) Response Regulator Receiver Signal Transduction Histidine Kinase
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HATPase_c HisKA HATPase_c_5 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ABA23581
JGI: Ava3976
CyanoBase: Ava_3976
CYORF: Ava_3976
UniProt: Q3M605
Position
4929351..4930646
Genome map
AA seq 431 aa AA seqDB search
MRATVPNQNYFSDRTPIKGIILAVDDNPNNLQVLSSFLDNSSFEVWAARSGEKALQRLEN
DLLPDLILLDVMMPGMDGFETCQRLKSDQRFCDIPVVFMTALSETEDKVKGFQLGAVDYI
TKPFQHEEVLVRIEHQLKLRHLTASLIAKNAELQKTQTQLIQTEKIASLGQMAAGIAHEV
NNPINFIAGNLTFVQKYVQEVVDLLYLYQQHFPNLPAEIENAINRTDLTYLLDDLSNVIK
SMRVGTDRVQEIVSSLNKFSRHRETGKKLANLHEAIENTLLILGHRLKANSERPAIEIVK
KYGNLPLIECYPGEISQVFMNLIANAIDAIEETQKNQNYCEIAENPGVIHITTELIGEQV
ICKIADNGAGISEEIQSQIFNAFYTTKPIGKGTGLGLSIAYQIVTVNHHGKISCHSQPGA
GLEFIIELPIN
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgactgtacccaaccaaaattattttagcgatcgcacaccaatcaaaggcata
attttagctgttgatgataatcccaacaatttacaagttttatcgagttttttagataac
tctagttttgaagtttgggcggcgcgcagtggtgaaaaagccttacaaaggttagaaaat
gatttattacccgatttgattttactagatgtcatgatgccgggtatggacggttttgaa
acttgtcaacgtcttaaaagtgaccagcgtttttgtgatattcccgtggtattcatgact
gcactgtcagaaactgaggataaagtcaaaggatttcaactaggagcagtagattatatt
accaaaccttttcaacatgaagaagtgttggtgagaatagaacaccagctaaaattgcgc
catttaacagcaagtttaatcgccaaaaatgctgaactgcaaaaaactcaaactcaacta
attcaaaccgagaaaattgctagtttaggtcaaatggcagccgggattgcccatgaagtt
aataaccccattaactttattgcgggtaacttaacctttgtgcaaaagtatgtacaagaa
gtagttgacttactttatctgtatcaacagcattttcccaatctacctgctgaaattgaa
aatgcaattaatcgaactgatttaacctatttattagatgatttatctaatgtgatcaaa
tctatgcgcgtaggtacagatcgcgttcaagaaattgtctcctcattaaacaaattttct
cgacacagagaaacaggtaagaaactagctaacctccacgaagcaatagaaaatacacta
ctaattctcggacatcgactaaaagccaattctgaacgtcctgccattgaaattgtcaaa
aaatatggtaatttacccttgattgaatgctatcccggtgaaattagccaggtatttatg
aatttaatcgccaatgccattgatgctattgaagaaacacaaaaaaatcaaaactactgt
gaaattgctgaaaatcctggggtcatccacatcacaactgagctaattggtgagcaagtt
atttgcaaaattgctgacaatggtgcaggaattagtgaagaaatccaaagtcaaatattt
aatgctttctacacaactaaacccatcggtaaaggaactggtttaggtctatcgatagct
taccaaattgttaccgttaatcatcacggcaaaatatcatgtcattcccaaccaggagca
ggtctagagtttataattgaattacccataaattaa

DBGET integrated database retrieval system