KEGG   Anabaena variabilis: Ava_4104Help
Entry
Ava_4104          CDS       T00277                                 

Definition
(GenBank) DevC protein
Organism
ava  Anabaena variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5107312..5108469
Genome map
AA seq 385 aa AA seqDB search
MAAITPVAWLQLIHRKPRLLVTITGVTFAVMLMFIQLGFRDGLFEDAVVFHKQIQADLVL
LHRDTERFFDMKVFPRRYLYNISAVDGIESVNPFYFSVTNFKNPETFVSRPIAIAGFTPD
QPVFNLPEVNQQAEVIKAANTILFDRLSRPEFGSIVENLEKHGEVTTDVSNRQIKVRGLF
SLGGGVMTADGVIITSDLTFSEILNHPLEKVQMGVIKVKPGVDPQSIIKKVSQDLPQELK
IMTLADYIQLEKDILAQSTPIGFIFNMGTVIGCVFGGIIVYQILYTQISDSIFIYATFKA
IGYANSYLVKVVLQQAFLMSLIGYIPGFAICMYLYSFVQEATRLPMIMTITRGVMVMLLT
IIMCSIAGMLAMNKLRSADPAELFG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggctgctattactcccgttgcttggttacaactaattcatcgtaaacctcgtttatta
gttaccattactggcgttacttttgcagtaatgttgatgttcattcaattgggttttaga
gacggactttttgaagatgctgttgtatttcataaacaaattcaagcggatttagtatta
ctgcatcgtgatacagagcgtttttttgatatgaaggtgtttccgcgacgctatctgtat
aacatctcggctgtggatgggatagaatcggttaatcctttctatttttcggttactaac
ttcaaaaatcctgaaacttttgtcagcagaccaattgcgatcgctggttttacacctgat
caacctgtgtttaatttaccagaagtcaaccaacaagcagaagtaattaaagctgctaat
accatattatttgaccgactgtctcgacctgaatttggttccattgttgagaatttagag
aaacatggcgaagtaacaacagatgtatccaatcgccaaattaaagtgagaggattattt
tctctaggaggtggtgtaatgacagcagatggtgtgattatcaccagtgatttaaccttt
tctgaaattttaaatcacccattagaaaaagtgcagatgggagtgattaaagttaaacct
ggtgttgacccacaaagtatcatcaaaaaagtctcacaagacttacctcaagaactaaaa
attatgactctagcagattatatccaactagagaaagatattttagcacaatccacaccc
attggattcatttttaatatgggaacagttattggttgtgtattcggtgggattattgtt
tatcaaattctctacacacaaatttctgatagcatatttatctacgctacatttaaagct
attggatatgcaaattcatacctagtaaaggtagttttacaacaagcatttttaatgtcc
ttaattggatatatccctgggttcgctatttgtatgtatctctatagctttgttcaagaa
gctactcgtctaccgatgattatgactatcactaggggggtgatggtgatgttactcaca
attattatgtgttctattgctgggatgctagcgatgaataaactacgttctgctgatcca
gccgaactttttggctaa

DBGET integrated database retrieval system