KEGG   Anabaena variabilis: Ava_4160Help
Entry
Ava_4160          CDS       T00277                                 

Definition
hypothetical protein (EC:3.4.21.10)
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
ava  Anabaena variabilis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5188000..5207745)
Genome map
AA seq 6581 aa AA seqDB search
MDANQPLESAPLVNSATNPLTIEGLTANTVTFTGGAAGDSLYLRVNADRLEYSTDNTNYS
SVDAIFTFSSQTQINVNLLAGDDSLFLDASLIQILQTTGGQLSFAGGADADTIFGPGGVN
VNWNITGTNAGNITDIFEFTETENITGRGNDTLTGLNQANLWTITGNGTGTLNDQISFND
IDNLIGGSLQDTFAINGATTVNINAGAGADIFELSNGSTLSGTIDGGTGIDTLNYSADTT
AQQVTLTGLGSSDGFAGTSNLTQQFTNIDNVIGGSGNNTLTGLNASATWEIDGTNRYIST
NNLSFTGFSNLTGGSNADTFIITGNQTADLRGQAGADRFQFNNAANLTGTIDGGTDSDTI
DASAYTTAQQVNLTGLGSSDGFAGTSNLTQQFTNIDNVIGGNASNTLTGLNASAIWEIDG
TNRYISTNSLSFTGFRNLTGGSNTDTFIITGNQTADLRGQAGADRFQFNNAANLTGTIDG
GTDSNTIDASAYTTAQQVTLTGLGGSDGFAGTHSSIIGGFTNISAIAGGTGTDTLIGLNA
SATWEVDGTNRYLSTNILEWNSFENLTGGNQADLFQLSVNPTGLITGGTGEDTLDFSNFP
TAINLTLNGANITGFNGTGTVSFAGIDTIVGSANTRDTLTANPTAFSESEWNLDADPTFS
DRTHTLKFSRIEDLTGKNNIRLSGATVTSTIDQDLTLRYNANTTTIELFNNLTSTVIDST
VITPSVDNLIKVIGTAGADKLTIDASVANAGLAVVFDALAGVDELNLSGFTTPKRTVLEK
NDTNGFSGIGPVAFLGVDKLTGSNVTGDTLEDKTGALISSWQINNISTYDDGTHTLDFTG
FTNLVGGIGIDTFNIIGTQTANLIGGAGADVFRFANNATLTGAIDGGTGADTLTYAEYTS
PRQVTLTSIGSQDGFTGTEATISVNFTNINTLSGGSGNDTLTGINAAANWEIDGTNVYLS
TNSLSFSGWENLIGGNNVDTFVISGTQTVNLTGGAGADTFQFNQSASLIGAIDGGTGADT
LNYAAYTTARQITLTNLGSSDGFIGTETTISNNFTNIDVVVGSSGNDTLTGINAAANWEI
DGTNRYISTNSLDISGVENLTGGSNADTFTISGAQTANIIGGAGADTFQFNDTATLTGTI
DGGTGADTLDYAAYTTARQIALTDLGIRDGFSGTDAAISNGFNNIDTIVGSSTTDTITGI
NAAANWEIDGTNRYLSTNILNFSGIENLVGGSDADTFTISGAQTANIIGGAGADTFQFND
TATLTGTIDGGTGADTLDYAAYTTARQIALTSLGISNDWNGTEAAITEGFKNIDTIVGSS
ATDTLTGINAAANWEIDGTNRYLSTNILNFSGIENLVGGNNVDNFVISGTQIANLIGGSG
SDTFQFSDTATLTGTIDGGTGVDILDYTAYTTNRNVILTTYGQIDGFVGTEDSFDEGYFT
NIDNIEAGTSNSDNIFGVSATALWILNNTGRYESTNIIDVLNPIDRILNFSNFENLIGGA
GTDTFRIEGTQTVNLSGREGTDNFEFADAATLIGDIDGGKDTDKLDFAAYTTARQVALFQ
AGNVDGFVGKESAISNLFFNIDEIIGGTQTDTLIGTNVAADWLLNDTNWYINRNDNDIEP
NDINFSSFENLVGGSETDIFSINGTQTVNIFGQGGADTFLFANGADFTGAIDGGTENDRL
DFSNSNTGVQIALTGLGDSQGWNGQQDENLFFNIDGIVGGSGTDSITGLDEAATWLLEDR
SQAETDWYIIKDESLNDKSLYLDNFEIFAGGSKADAFRVSGTHTINLFGQDGDDSFVFTD
QAVLNGVIDGGAESDTLDFAAYTTARQVTLFTLGIIDGFIGTATGISQNFFNIDAIAGSS
ADDTLTGVDAEATWQIDDGSWYFSNEQQVYLTSFENLVGGIGPDQFTITGTSTINLFGGA
GDDVFQLLDNVGIVGAIAGGTGKDVLDYSFYTTGITVNLTVGSATNITNGIQGIENVTGG
ISNDLIIGDSQDNTLAGSGGNDTLNGGDGDDTLIISVLGISTVDGGNGKDTLVVRGSEDA
DNLEVANNKITTADGTLELVNWTGVEAVEVKTLAGDDVITVSVTDGSPKITLDGGAGQDS
LSSNNQTNVWTMTSGLSGTLTTGDVNPVTINYLDIEKLVGGAGKDTLVVGAFVPPDNRPE
PPKPPEPPEPPEPPEPPRPLPEPIPQQPAPPIPPRPPIILPPIPIPIPIPPIPIPIPIPP
IPIPIPIPPPPPPPPPIPPRPEPPPPIPPRPEPPPPIPPRPTKAEKPDPEEQDPDREEEE
EETPCEATQTFDGGTGENALQAGDCANVWTITGFNSGTLTSGAGIKTFSGIGTLIGGASS
DIFIFSLGGSLSGSIDGGGIALLNSLEAGPGNNDWTIAGSNAGTVTNLASGFKNIATVRG
GLGADTFTLEAGGSLDGSIEGGGLANLNTIKGSNQSLDWTIAGANTGSVTGVSLGFTNIG
NLVGSSSSDTFTLTVAGSLAGSIDGNGGNNTLQGVSVENTWTITSNDTGSIDNIAGTLEF
SDIANLIGGNADDTFILENNSQITGEIVGGGGNNTLQGGSVENTWTITSNDTGSIDNIAG
TTEFSDIANLIGGDGDDTFILEGDSQITGEIAGGGGNNTLQGGNVDNEWTIVTDNMGDLT
NIGSGEITSFREIANLIGGNQADTFTLSEDSHITGTIDGGNGKNTLEGGDSYNTWTITDE
NAGNISNSDGTTNFTEITNLIGGDDDDIFILENNSQITGEIAGKEGDNTLKGGNVRNTWT
ITAENAGYIENRGDNTNFTQITNLIGGNDDDTFILEGDNRITGEISGGGGNDTLEGGNVS
NTWRITDNNAGVVENSTGRTEFNQIAYLTGNDQADIFILEDNSHITGAIAGGGGTNTLQG
DNVRNTWTITAENAGNITNRDGTTNFTQIANLIGGNDDDTFILQGDNHITGEIAGRTGEN
TLQGGDVENNWTISDENAGEIDNQGGRTNFTEISNLIGGNDDDTFILRADNRITGEIAGR
AGDNTLEGGNAENTWTITDENAGNITNNSGSTAFTEIANLTGGNDNDIFILDEDGYITGA
IAGGEGDNTLQGGNVENNWTINAENAGTVDNGNDTTAFREINKLIGGNDEDTFVFEDNGL
SNFDFTVDGGQGDPQLNTLEINADTDLNWLINRQNGGEVSGEDLLLEFDNIANLTGSAGN
DEFKLEDATVAEGGTIDGRAGVNSLSGGITDTTNTWVVNGVNSGNFTATKDGTTYTFDFT
NIQNLNGSDADDVFKLQGGVLYGSGAINGGGGKDTIEQQGSADDDDDDFTTTWTLTDEDS
GTISDSTPETFTVNGQTVTTNLVLRNGFTNIENLVGGADEDVFIVNDGVTFTGNIDAGDG
GDTVIVNGTGTITGSVSGGENTNGTVDVIDLSGIADPVVFNLQDINFSEFEVVIGNNQNS
TIIGSDQPNTWEITGENEVVIENITFIGFNNLVGGAGVDTFNFTAADAVVHIDEEVPPDA
TGEVFSLALITGNLLARLLARNPEDTVTISDVDGTIVTGDESTVIAGNYGRLNINEDGTY
SYAVELSDPAVVNLPVGASLTDTFSYTIEQGTNSITTELIVTIQNTADGLIMTDNVNSID
ITGSISAGGGDDIFNFANDALISAVINSDAGGDNFNFADTAQVVGTVDGGDNLADTSDVV
DFSQASGTVVINLGDNNFNNIETFIGNGIGTTLIASDTNNTWTINVSNGFALEDLGIFGV
SNTLNQGGSNTNIEFNYIGNLTGGSGNDTFKIKSTTLTVNGKEQVDWGVIGKIDGGQGNN
AILMDGINTVGITWEIDGGNAGKAYDQLSLVGGFNSLGQPVPPARFSFDRITFQQPHNLL
DGQTVLYAHEYYLPPDISTPEDINYDLSGLKRGELYTVRRINESTISLVDNQGKTVTGLS
FPSIPGTSITGTHWLTKQVRLNFQNIGDITGDGNNDTFFLRPHGSLSGTIDGGGGNNSLQ
GSDTANIWSIEGFNAGKIFPSTGLTFDGSSSSVVNTGNNITFSYRHNLVTGDRVQYRNGT
NQANGDIGGLVSGDFYQVIRQDDFTVKLTNLSNSNFPISLSPTIDGGNNHELIKTNTFIG
SEGVERNPLLNLGQYDYVAYDSSRVDTTNKTITFSSAHNFVTGDLVQYQYAYQAGETETL
VNREYYRVIRQDNLTIQLTQTGSNIPIDLQSAIPLNGPQFLVKANDVNRIRSSAENIPGL
NVSEFTGEFIEFARPHNLSNGQAVAFRALSDDRSSLNDWNLEKYEEGVGDSIIYYAIKID
DYRIALANSFSNAIGRIPIFLGFDGSMEGQLTPVSNFQRIESLFGGASSDFFSIKNGRIG
GFDTNSGGIFGRGGINTLKQSPSDIWNLRGIDRGETNFVFQFSQISNLIGSNVNDTFIVN
KNARLTGSIDGDSGDNTLQSNSANFVNWTISGQNAGLLQGEQEEQGLSFNRLGGGTILTS
DFRRNHNLVTGQAFSNYFVIKLNNQEIQLAATLEDAFAGQAISLTSDRYSGIPKTAISFN
NITRLEGSDNADTFTIADERVVSSINGKGGNNTLQALNVLNQWLVTGTDAGSLSFSPIEG
NNATINFTNVGNLQGGTERDRFTLAGGTLSGTVNGEGGDDTLAIDSNITTTWTVTGADAG
TVTGITGGFSNIANLKGGNRENTFILDNNGSLSGNIDGGLGADTFIIGGGGSLSGFNSID
GGGFADINTIQIANTNGRPYTWEITGADRGNLQGAINLFSNIGKLVGGSGGNTFIFQPGG
SLSPGGIIDGGRVSSPLNTLQINSTLALNWSINSQDTGLVQGQNFLLSFSNIANLKGGFN
TDTFLMNNAAVSPGGTIDGGTGVNLLLGGFSGITNTWIVNGINSGIFVAPQTTFNFSNIQ
NLNGSNADDVFKLRGGVLFGSGSIDGGGGDDTIEQEENVTTTWTLTGDGAGKVSDATPET
FTVNGVTVTTSEILKDGFRNIENLIGGAEADIFIVNDGVTFTGGVDGGGGSDRFNFNGTS
QITGNIGGGNDDVGGVDLLDFSGFTGTVTIDLNNPALTGIETIIGNGANTTIIGKNTANT
WTVNDANGTVNGLTFTNVHNLRGGSDIDTFNIQSATNAITIDAGAGDDQIKIGNLTPNLG
GTVNNITGALTITGGEGNDQLTIDDSGDTAASTGTLTATTITGLSPSSITYGTVETLNVN
LGSGANNFTVQGTTAVTTIIGGSGDDIIDASASSQAITIFGNAGNDRITGGAGNDRLDTG
TGQDFVIGGAGNDFITVQGTSGGGTTVLGGLGDDRIEIGTPLADAGRVGRTLNNLLAGLT
INGEAGVDTLGVYDDFDTIANTGSITFNNILGLGMAASGLFYIGIENLTVELGDGANSFT
VQNTNPNATTTITGGSGVDTINVQTINSVTTINGDAGNDVINVVSPGAPTVNTIAAGLTI
NGGADTDTITINDSGDTAANTGTLTSTTITGLSPATITYGTAETLNINLGAGADTFTISS
TSATTTINAGVGNDTLNVLAIANATTLNAGIGNDVINVGSATTPTVNGITAALTINGGAE
TDTVNINDSGDTAANTGTLTSSTITGLSSGSITYGTVETLNINLGAGADTFTVSSTSVTT
TINANGGADTLNVEAISNAITLNAGAGNDVINVGSATTPTVNGIAAALTINGGTETDTVN
INDNGDTAANTGTLTSSTITGLSPSTITYGTVETLNINLGAGADSFTVSSSSATTTINAG
GGADTLNVLAIANATTLNADAGNDVINVGTAGTLAANGIAAALTINGGSETDTITINDSG
DTAANTGTLTSTTITGLSSGTITYGTAETLNINLGTGADTLTVSSTGAATTINANGGNDT
LNVQAIANATTLNADAGDDVINVGGGTPNTVNAIAAALTINGGADTDTITINDSGDTANN
TGTLTATALTGLGSNGITYGTVETLNINLGSGSNNLTVQGVSAATTITGGSGNDTINASA
INQAIAIYGNAGNDNITGGGGNDTLDSGTGEDTVTAGGGNDLIYVQGTSGAGTTINGDAG
NDVINIGSSTSNTVNTIAAALTINGGNGIDTVNINDSGDTAANTGTLTSTAITGLSPATI
TYGTVETLNINLGAGADTLTVSSTSATTTVNAGGGNDTLNVLAIANATTLNADAGNDVIN
VGSAEATILNVIASDLTINGGDNADTININNSANTANNSGGLSSTTIDGLGLRRPINYST
VETLNINLGTGADRFTISSTGAVTTINTGGGNDTVNVEAISHATTLNTGAGNDEINVGNR
GLRTVNDIAAALTINGGADTDTVRINDTDDNTNNTGTLTATTITGLSPTTITYGTVETLN
IELGRGADTFTVSSTSATTTINAGDGADTLNVQAITNATTLNAGTGNNVINVASAGTPTV
NGIAAALTINGGPENNSLEVRDSGDTTANTGTLTDTQLTGLGMTGGITYREITNLSIRLG
SGNNNFTIASTFPRTTTSIYGNVGAETFNVRSIRSSTNIFAAGGNDTINVSTSAPNGGGI
VNEILALLFVDGGAGGDTLNVDDRGDGAPNNGTMTANTITGLGMSNGISYTLLEATNILL
GSGNDIFTINSKIPGSSILVDGGPGIDLIFDFTFSAIVRNA
NT seq 19746 nt NT seq  +upstreamnt  +downstreamnt
atggacgctaaccagccactagaatctgcacctttagtaaactctgcaactaatccgtta
acaattgaagggttaacagcaaatacagtaacttttacaggtggtgcggctggggatagt
ctttatctgcgagtcaatgctgataggttagagtacagtactgacaatacgaattactct
tcagtagatgcgatattcaccttctcatcccagactcagatcaatgtcaatctcttagct
ggggatgattctctatttttagatgcgtctttaattcaaattctacaaactactggtggg
caattatcatttgctggtggtgcagacgcagatacaatatttggccctggtggagtaaat
gtcaactggaatatcacaggaacaaacgctggtaatatcacagatatatttgagttcaca
gaaacagaaaacatcacaggccggggaaacgatacattaactggtctgaatcaggcgaat
ctgtggactatcactggcaatgggacaggaacgctaaatgatcagattagctttaatgat
attgacaacttgattggtggcagtctacaagataccttcgccattaatggtgccacaaca
gtcaatatcaacgctggtgcaggcgcagatatttttgagttgagtaatggctctacattg
agtgggacgattgatggtggtacgggaattgatactcttaattattctgccgacaccaca
gcacaacaagtcactctcacaggtctaggtagtagtgatgggtttgcaggcacaagcaac
ctcacacaacaatttaccaatattgataacgtcattggtggtagtggcaataacacactc
acagggttaaatgcctccgctacatgggaaatagacggcacaaatcgttacatcagtacc
aataacctcagtttcacaggcttcagcaatttgactgggggtagcaatgccgacaccttt
attattactgggaatcaaacggctgatttaagaggtcaagctggtgcagatagattccaa
ttcaacaatgctgccaatttaactggcacaattgatggcggtacagactccgataccata
gatgcgtccgcctacaccacagcacaacaagtcaacctcacaggtttaggtagtagtgat
gggtttgcaggcacaagcaacctcacacaacaatttaccaatattgataacgtcattggt
ggtaatgcaagtaacacactcacagggttaaatgcctctgcgatatgggaaatagacggt
acaaatcgttatattagtaccaatagcctcagtttcacaggcttcagaaatttgactggg
ggtagcaataccgacacctttattattactggtaatcaaacggctgatttaagaggtcaa
gcgggtgcagatcgattccaattcaacaatgctgcgaatttaactggcacaattgatggt
ggtacagactccaataccatagatgcgtccgcctacaccacagcacagcaagtcaccctt
acaggtttaggtggtagtgatgggtttgcggggacacacagcagcatcatcggaggattt
actaatattagtgcgatcgcaggtggtacaggcacagatacactcatcggtttaaatgcc
tctgctacctgggaagttgacggtactaatcgttatctgagtacaaatatcttagagtgg
aatagctttgaaaacctgactggtggtaatcaagccgacctattccaattgagtgtcaat
cccacaggactaattactggtggtacaggcgaagataccctcgactttagcaacttcccc
acagcaattaatctcactctcaatggtgcaaatatcactggatttaatggtacagggaca
gtcagctttgcaggtattgataccatagtcggttccgcaaataccagagataccctcaca
gccaatcctaccgcctttagtgaaagtgagtggaatttagatgctgatcccacctttagc
gatcgcactcacaccttaaaattctcccgcatcgaagacttaacgggtaaaaacaacatc
cgcttatctggcgcgacagttaccagtaccatcgaccaggatttaaccctgcggtacaat
gccaacaccacgaccattgaattattcaacaatctcacctcaacagtcattgattccact
gtcataactcccagcgtcgataacctcatcaaagtcatcggtacggcgggagcagataaa
ctgacaatagatgcttctgtagctaatgctgggttagcagttgtctttgatgccttagcc
ggagttgatgaattaaatttaagtggtttcacgactcccaaacgcacagttctagaaaaa
aacgatactaatggttttagtggtattgggccagttgcctttttaggtgtagataaactc
acaggctcaaacgttacaggcgacaccctcgaagataaaacaggggcattgattagtagc
tggcaaattaataacatctccacctacgacgatggcacccataccctagatttcacaggc
tttaccaatcttgtcggtggcattggcatcgacacctttaatattatcggtacacaaaca
gctaatctcatcggtggtgcgggtgctgatgtcttccgatttgccaacaatgccaccctc
acaggtgcaattgatggtggtactggtgcagataccctgacttatgcagaatataccagc
ccacgacaagttaccctgactagcataggtagtcaagatggctttaccggtacagaagcc
acaatttccgttaactttaccaacattaataccttaagtggcggcagtggcaacgatacc
ctcacagggattaacgccgccgccaattgggaaatcgacggcacaaatgtttatctcagc
accaatagtttgagtttctctggatgggaaaacctgattggtggtaacaatgtcgatacc
tttgtgattagtgggacacaaacagttaatctcacaggtggtgcaggtgcagatactttc
caatttaatcaaagtgcgagtctcatcggtgcaattgatggtggtacaggtgcagatacc
ctcaactatgcagcctacaccaccgccagacaaatcaccctgactaacttaggtagcagc
gatggttttatcggtacagaaacaacaattagcaataactttaccaacattgatgttgta
gtcggtagtagtggcaatgataccctcacagggattaacgccgccgctaattgggaaatc
gacggcaccaatcgttatatcagcaccaacagtttagatatttcaggcgtggaaaatctc
actggtggtagtaatgctgacacctttacaatatcaggcgcgcaaacagctaatatcatt
ggtggtgcgggtgcagataccttccaattcaatgacacagccaccctcacagggacaatt
gatggcggtacaggtgcagacaccctcgactatgcagcctatactacagccagacaaatt
gctctcacagatttaggtattcgtgatggctttagcggcacagatgcagctattagcaat
ggttttaataatattgacacgatagttggtagtagtactactgacaccatcacaggaatt
aacgctgcggctaattgggaaattgacggcacaaaccgttatctcagcaccaatatcctc
aacttctcaggcattgagaatttagtaggtggtagtgatgctgacacctttacaatatca
ggcgcacaaacagctaatatcattggtggtgcgggtgcagataccttccaattcaatgac
acagccaccctcacagggacaattgatggcggtacaggtgcagacaccctcgactatgca
gcctatactacagccagacaaattgctctcacaagcttaggcattagtaatgactggaat
ggaacagaagcagccattacagagggatttaagaatattgacacaatagttggtagtagt
gctactgacaccctcacagggattaacgctgctgctaattgggaaatagacggcacaaac
cgttacctcagcaccaatatcctcaacttctcaggcattgagaatttagtgggtggtaac
aatgttgataactttgtcatatctggcacacaaatagccaacctgataggcggatctggc
tcagatacgttccaattcagtgacacagccaccctcacagggacaattgatggcggtaca
ggtgtagatatcctcgactacacagcctacaccacaaatcgcaatgttatcttaactacc
tacggacaaatagatgggtttgtcggcacagaagattcttttgatgaaggctactttact
aacattgataacatcgaagccggaacatcaaatagtgacaacatctttggggtatctgcc
acagcattatggatactgaacaatactggtaggtatgaaagtaccaatattatcgatgtc
ctcaatcccatagacaggattctcaatttcagcaacttcgagaatttaattggtggtgca
ggaacagatacatttaggattgagggaacacaaacagtcaatctttcaggtagagaggga
actgacaactttgagtttgccgatgcagctaccttaatcggtgatattgatggcggcaaa
gataccgacaaactagattttgctgcttacacaacggcgcgacaagtcgccttgtttcaa
gcgggaaatgttgatggctttgtcggcaaagaatccgcaattagcaatttattctttaat
attgatgagattattggtggcacacagacagatacactcattggtacaaatgtagcagcc
gactggctactaaatgatactaattggtatatcaataggaatgataatgatattgagccg
aatgatatcaatttttctagctttgaaaatttagttggtggctctgaaacagatattttt
agtattaatggcacacaaacagtcaatatctttggacaaggtggcgcagatacattcttg
ttcgccaatggtgctgactttacaggtgcaattgatggcggtacagaaaatgatcgcctt
gattttagtaactccaacacaggagtgcaaattgccctgactggactaggagatagtcaa
ggctggaacggacagcaagatgaaaatctctttttcaatattgacggaattgtcggggga
agcggaacagactcgatcacaggcttagatgaggccgctacttggttactagaagacagg
tcacaggcagaaaccgattggtatattatcaaagatgaatcgctcaatgataaatcgctt
tatctagacaacttcgagatatttgctggtggttcaaaagccgacgcttttagggttagt
ggtacacacaccatcaatctctttggacaagatggtgatgatagctttgtattcaccgat
caggctgtcttaaatggagtaattgacggcggtgcagaatcagatactctcgactttgca
gcctacacaacagcaaggcaagtcaccctgtttaccctgggaattatagatggttttata
ggcacagccacaggaattagccagaacttctttaacattgatgcgatcgcgggtagtagt
gccgatgataccttaactggtgtagatgcagaagctacttggcaaatcgacgatggtagc
tggtatttcagtaacgaacaacaagtatatttaactagttttgaaaatttagttggtgga
attggccctgatcagttcacaattacaggtacctctactatcaatctcttcggtggtgca
ggcgatgacgtattccagttgttagataatgttggaattgtgggagcgatcgctggtggc
acaggcaaagatgtcttagactattctttctacaccacaggcatcaccgtcaatttaact
gttggtagtgctactaacatcactaatggcattcaaggtatagaaaatgtcacaggagga
attagcaatgacttaatcataggcgatagtcaggataataccttagctggaagcggcggc
aacgacaccttaaacggtggtgatggcgatgataccttaattatctctgttttgggcatt
tccactgtagatggaggtaatggaaaagataccctcgttgtccgaggtagtgaggatgca
gacaacctagaagttgccaataacaaaattaccaccgccgacggcactctagaattagtc
aactggactggagtcgaagcagttgaggtcaaaaccttagcaggagatgacgtaattaca
gttagcgtcacagacggtagccccaaaatcaccttagatggcggtgcaggacaagattcc
ctctcttctaacaatcaaaccaacgtctggacaatgaccagtggcctttctgggacactg
accacaggagatgttaatcctgtaactatcaactatctagacattgagaaactcgttggt
ggagcaggtaaagatactctagttgttggtgcatttgtacccccggataatcgaccagaa
ccaccaaaaccaccagaaccaccagaaccaccagaaccaccagaaccaccgagaccgcta
ccagagccaataccacaacaaccagcaccgccaataccgccaagaccaccgataatctta
ccgccaataccaataccaataccaataccaccaataccaataccaataccaataccgcca
ataccaataccaataccaataccgccgccaccaccaccaccaccacccataccaccgcga
ccagaaccaccgccaccaataccaccgcgaccagaaccaccaccacccataccaccgcga
ccaacaaaggcggaaaagccagatccagaggagcaagatccagatcgggaggaagaggag
gaagaaactccctgcgaagccacacaaacctttgatggtggcacgggagagaatgcctta
caagcaggtgattgtgccaatgtttggacaattacaggattcaattcgggaacactcaca
agcggtgcaggtatcaaaaccttctctggtatcggcactctcatcgggggagcgtccagc
gatatcttcatcttcagtcttgggggcagcttaagtggttctattgacggcggcggtatt
gccttactcaatagcttagaagctggcccaggaaacaatgactggacaatcgctggtagc
aatgctggaactgtcactaacttggctagtggatttaaaaatattgccactgtccggggt
ggattaggtgctgataccttcacactggaggctggaggcagtttagatggcagcattgag
ggtggcggattagctaacctcaacaccatcaaaggcagtaatcaatctctggactggacg
atcgctggtgctaacactggtagtgtcacaggagtctctctcggctttaccaatatcggt
aatttagtcggtagtagtagcagtgatacatttaccctgactgttgccggcagcctcgca
ggtagcattgatggcaatggtggcaacaacaccctacaaggggttagtgtcgaaaatacc
tggacaattaccagtaacgatacaggcagtattgataatattgccgggacacttgagttt
agcgacattgctaacctgattggtggtaatgcagatgacaccttcatcctggaaaacaac
agtcaaatcacaggcgaaatcgtcggtggaggtggtaacaacaccctacaagggggtagt
gtcgaaaatacctggacaattaccagtaacgatacaggcagtattgataatattgccggg
acaacagagtttagcgacattgccaacctgattggcggcgatggagatgacaccttcatc
ctggaaggtgacagtcaaatcacaggcgaaatcgctggtggaggtggtaacaacacccta
caaggtgggaatgtcgataacgagtggacaattgtcactgacaatatgggtgatctcacc
aatattggtagtggcgagataacttcgtttagggaaattgccaacctcatcggtggtaat
caagctgataccttcactctgtcagaagacagccacatcacaggcacaatcgatggtggc
aatggtaaaaacaccctagaaggcggtgactcatataacacctggacaattacagatgaa
aatgctgggaatatcagcaatagtgacggcacaaccaactttacagaaataaccaacttg
attggtggtgatgatgatgacatcttcatcctggaaaataacagtcaaatcacaggtgaa
atagctggtaaagaaggcgacaataccctcaagggcggcaatgtcaggaatacttggaca
attacggctgaaaacgcaggttatattgagaaccgtggtgataacactaactttacacaa
ataaccaacctgattggtggtaatgatgatgataccttcatcctagaaggagataaccgc
atcacaggcgagatatcaggcggtggcggtaacgataccctagaagggggtaatgtcagc
aatacctggagaattaccgataacaatgccggggtagttgaaaatagcacaggtagaaca
gaatttaaccaaatcgcctacctcacaggtaatgatcaagctgacatcttcatcctagaa
gacaatagccatatcaccggggcgatcgctggtggtggaggtacaaataccctccaaggt
gataatgttaggaatacttggacaattacggctgaaaatgccgggaatatcaccaatcgt
gacggcaccaccaactttactcaaatcgccaacctgattggtggtaatgatgatgacacc
ttcatcctgcaaggagataaccacatcacaggtgagattgcaggtagaacaggcgaaaac
accttacaaggtggtgatgtcgagaataattggacaattagcgatgaaaatgcaggtgag
attgataatcaaggcggtagaaccaactttacagaaattagcaacctgattggcggtaat
gacgacgataccttcattctgcgagcagataaccgcatcacaggtgagattgcaggtaga
gcaggtgacaacaccttagagggcggtaatgctgagaacacttggacaattaccgatgaa
aatgccgggaatattaccaataattccggaagcacagcctttacagaaatagctaacctg
accggtggcaatgacaatgatatcttcatcctcgatgaagatggctacattacaggtgcg
atcgctggtggtgaaggtgacaataccctacagggcggtaatgtcgagaataactggaca
attaacgccgaaaacgctggtacagttgacaatggcaacgacaccaccgcatttagggaa
attaacaaactgattggcggtaatgacgaagatacctttgtctttgaggacaatggctta
tcgaactttgattttacagttgatggtggacaaggcgacccacaactaaataccctagaa
atcaatgctgatacagacctcaattggttaatcaaccgtcaaaatggcggagaagtgtca
ggagaagacttactcttagaatttgacaacattgccaacttaacaggcagtgcaggtaac
gatgaatttaagttagaagatgccactgttgccgaaggtggcacaatagacgggcgtgcc
ggagttaacagcttaagtggcggaattactgatactaccaatacttgggtggtgaatggg
gttaatagtggcaatttcaccgccactaaagatggcacaacttatacctttgacttcacc
aacattcaaaacctcaatggtagtgatgctgatgatgtcttcaagttacagggtggtgtg
ctgtatggttccggcgcaattaatggtggtggcggtaaggataccatcgagcaacaaggt
agtgccgacgatgatgatgatgactttacaactacctggactttaaccgacgaagattcc
ggtacaatctccgattccacaccagaaaccttcaccgtcaatggtcaaaccgtcaccacc
aacttggttctcagaaatggcttcaccaacattgaaaatcttgtgggtggtgcagatgaa
gatgtatttattgtcaatgatggtgtcaccttcacaggcaacattgacgcaggcgatggt
ggcgatacagtaattgtcaatggtacaggcacaattactggctcagtcagtggtggagag
aatactaatggcacagtggatgtcatcgacttgtcaggcattgctgatccggtagtgttc
aatctacaagacattaacttcagcgaatttgaagttgtcatcggcaataaccaaaacagc
accatcatcggctcagatcaacccaatacttgggaaattactggcgaaaatgaggtagtg
atcgaaaacattacctttattggctttaataacttagtgggtggtgcaggtgtcgatacc
tttaacttcacagccgcagatgcagtagtacatattgatgaagaagtaccaccagatgcc
acaggtgaagtctttagtttggcactgattacaggcaacctactggcgcggctattggca
cgtaatcctgaagataccgtcaccatcagcgatgttgacggcacaatagttacaggtgat
gaatccactgtaattgcaggtaactatggcagactgaatattaatgaggatgggacttac
agttatgcagtggagttatcagatccagccgtagtcaacttacctgtaggtgccagcctg
accgatacatttagctacacaattgagcaaggtacaaacagtattaccactgagttgatc
gttaccatccaaaacactgccgatggcttgatcatgacggataacgtcaacagcattgat
attacaggtagtatcagtgctggtggtggtgatgatatctttaatttcgctaacgatgcc
ctgattagtgccgtaattaatagcgatgctggtggagataactttaacttcgctgatact
gctcaggtagttggtacagttgacggtggtgataatcttgctgatacatccgatgtagtt
gatttctcccaagctagtggcacggtggtaattaacctgggtgacaataactttaacaac
atcgaaacctttatcggtaacggtattggcaccaccttaattgcatctgataccaataat
acctggacaattaatgtctctaatggctttgcactggaagatttgggaatttttggtgtt
agcaacaccctcaatcaaggcggttctaatactaatatcgaattcaattatattggtaat
ttaacaggtggctcaggtaacgacacctttaaaatcaaaagcacaactttgacagttaac
ggtaaagaacaagtcgactggggagtaataggaaaaattgatggtggacaaggaaacaat
gcgatcctgatggatggtattaataccgtaggtattacttgggaaatagatggtggcaat
gccggaaaagcttacgatcaactgagcttagtaggaggatttaactcattaggacaacct
gtcccgccagccagatttagctttgatcgcatcacctttcaacagccccacaatttattg
gatggtcagactgtcttatatgctcacgagtattatctgcctccagatatttccactcct
gaagatataaactacgatctaagcggactaaaacggggtgagttatatacagtcaggaga
attaatgagtcgactatttcccttgtggataatcaaggaaaaaccgttactgggttgtct
tttccttccataccaggaacttccataacaggaacacattggttaactaagcaagttcgc
ctgaatttccaaaatattggtgacatcacaggtgacggcaacaatgatactttcttcctg
cgtcctcatggtagtttatcgggaacgattgatggtggtggtggcaataacagcttacaa
ggaagcgatacagctaatatttggagcattgaaggctttaatgctggcaagatattcccc
agcacagggctaacttttgatggtagttcttcctccgttgtcaatactggcaacaatatt
accttctcctatcgccataacttagtgacaggcgatcgcgtccagtatcgcaatggcaca
aatcaagcgaatggagatattggtggattggttagtggtgatttctatcaggtaattcgt
caagatgactttacagttaaactcactaatttatctaatagtaattttccaatttcctta
tccccaacaatagacggcggcaataaccacgaactgatcaagacaaacacctttatcggc
agcgaaggcgtagagcggaacccactacttaacctgggtcaatatgactatgttgcctac
gatagctccagagtcgatacaactaacaagacaattactttctccagcgctcataacttt
gtaacgggcgatctcgtccaatatcaatatgcttatcaagcgggtgaaactgaaacactt
gttaatagagaatattatcgagtcattcgtcaagataacttaacgattcaactaacacaa
acaggtagcaacatccccattgacttgcaatctgctattccccttaatggccctcagttt
ttagttaaggcaaatgatgttaatcgtatacgtagttcagccgaaaatattcctggatta
aatgtcagcgaatttaccggagaatttatcgaatttgctcgaccccataacttgtctaat
ggtcaagctgtcgccttccgcgctctcagtgatgatagatcatcgttgaacgattggaat
ctagaaaaatacgaggaaggagttggggatagcatcatctactatgcgattaagatagat
gattacagaattgccttggcaaacagtttttcaaatgccatcggaagaataccaatattt
cttggctttgatggaagtatggaaggacaacttacaccagttagcaacttccaaaggatt
gagtctctatttggtggtgcgagtagcgatttcttcagtattaagaatggtcgtatcgga
ggattcgataccaattcaggcggaattttcggtcgtggcggaattaatactttaaaacaa
agcccttctgacatctggaatttacgtggaattgatagaggggaaacaaatttcgtcttt
caattctcgcagattagtaacctcattggcagtaatgtgaatgatacctttattgtcaat
aaaaacgctcgcttgacaggtagcattgatggtgattcaggagacaataccttacaaagc
aacagtgccaattttgttaattggacaatttctgggcagaatgctggcttattacaaggc
gaacaagaggagcagggattatcatttaatcgtcttggcgggggaactatcttaactagc
gacttcagacgcaatcataatttagtcaccgggcaagctttctctaattactttgtgatc
aagctcaataatcaggagattcagttagcagcaactctagaagatgcctttgctggtcag
gcaatttctctcacaagcgatcgttactccggaattcctaaaactgctatttctttcaat
aacattactaggcttgagggtagtgacaatgcagataccttcaccatagctgacgaacgt
gtagtctcctcgatcaatggtaaaggtggtaataatactctccaagctctcaatgtactc
aatcaatggttagtgacaggaactgatgcgggtagtctgagtttctcacccattgaaggg
aacaatgcaaccattaactttactaatgtcggtaatttacaaggaggaacagaacgcgat
cgctttactctagctggtggtactttatcaggtacagtcaatggtgaaggtggtgacgat
actttagcgatcgattctaatattacgacaacttggactgtgacaggggcagatgcagga
acggttacaggtatcacaggtggtttcagtaatattgccaacctgaaaggtggcaataga
gaaaatacatttattctcgataacaacggtagtctctctggcaacattgatggcggttta
ggggctgatactttcattatcggtggcggtggtagtttatctggctttaactccattgat
ggcggtggctttgctgatattaataccatccagatagctaatactaatggcagaccctat
acttgggagattactggtgctgacagaggaaatctgcaaggagcgattaatctctttagc
aatatcggtaagctagttggcggttcagggggtaatactttcatcttccaacctggcggt
tcactcagccccggaggtattattgatggtggtagagtgtcgtcgccactaaatactcta
caaattaactctaccttagccttaaattggtcaattaacagtcaggatactggattagtt
caaggacaaaacttcttactttctttcagtaatattgctaacttaaaaggtggtttcaat
actgatactttcttaatgaacaatgctgctgtctcaccaggaggtactattgacggtggt
acgggtgttaatttactcctcggcggctttagcggtataactaatacctggatagttaat
ggcatcaatagcggtatttttgttgcacctcaaacaacctttaatttcagcaatattcag
aacctcaatggtagcaatgctgatgatgtcttcaagctgcgcggtggtgtgctgtttggt
tcaggctcaattgatggtggtggcggtgacgataccatcgaacaagaagaaaatgtcacc
acaacttggacattaacaggagatggtgcagggaaagtctctgatgcaactcccgaaacc
tttaccgttaatggtgtgactgttaccactagtgaaatcctcaaagatggtttcagaaat
attgaaaacctcattggtggtgcagaagcagatatctttatcgtcaatgatggtgttacc
tttacgggcggtgttgacggtggtggtggtagcgatcgctttaatttcaacggtacgtca
caaatcactggtaacattggcggtggtaacgacgatgttggcggcgtagatttactagat
ttctctggctttactggtacagtcaccattgacttaaataatcccgccttgactgggata
gaaacaattattggtaacggtgcaaacacaaccatcattggcaaaaacaccgccaacact
tggacagtcaacgatgctaacggtacagttaacggtttgacctttactaatgtgcataat
ctgcgtggtggtagcgatattgatacatttaatattcaatccgcaaccaacgccatcacc
attgatgctggtgcaggcgacgatcagattaagataggtaatctcaccccgaatttgggt
ggcacagtgaataatattaccggagcattaaccattactggcggtgaaggtaatgaccag
ttaactatcgatgatagtggcgatacagccgctagtacaggtactctcaccgccactaca
attacaggcttaagtcctagcagtatcacctacggtacagtagaaacactgaacgtgaat
ctgggcagtggcgcgaataacttcactgtgcaaggaactactgctgtcaccaccattata
ggtggctcaggcgatgacataattgatgcttctgcttctagtcaagctattaccatcttc
ggtaatgctggtaatgaccgcattactggtggtgcaggaaatgatcgcctagatactggt
actggtcaagattttgtcataggtggtgcaggtaatgacttcattactgtgcaaggaact
agcggtggaggcacaacagtattaggcggtttaggtgatgatcgtattgaaattggcact
cctctagctgatgctggcagagttggcagaactctcaataatcttttggctggcttaact
attaatggagaagcaggagttgacacattaggtgtttatgacgactttgatactattgcc
aacacaggaagtatcacttttaataacattcttggcttaggaatggctgctagtggactc
ttttacatcggaatagaaaatctaactgtggaattgggtgatggtgctaatagtttcacg
gtgcagaataccaaccccaatgctactaccaccatcactggcggtagtggtgtagacaca
attaatgtgcagacgattaacagcgtcaccacaattaatggagatgcaggtaatgatgtc
attaatgttgttagtcccggagcgccaacagtcaatacaatagcagctggtttaaccatc
aacggtggtgctgatactgacaccataaccatcaatgacagtggcgacaccgcagccaat
acaggcacattaaccagcaccacaattactggtttaagtcccgctaccatcacctacggc
acagcagaaaccctcaacattaatttaggtgcaggtgcagatacctttactatcagcagc
accagtgcgacaaccacaattaatgcaggtgtcggtaatgatactctcaatgtactagcg
atcgctaatgccacaaccttgaatgcaggtataggcaatgatgtgattaatgtgggtagt
gccacaacaccaacagtcaatggcataacggctgctttaaccatcaatggtggtgctgaa
accgacaccgtcaacatcaatgacagtggtgacaccgcagccaatacaggcacattaacc
agcagcacaattactggtttaagttccggtagcatcacctacggcacagtagaaactctc
aacattaatctgggtgcaggtgcagatacctttactgtcagcagcaccagtgtgacgact
accattaatgcaaatggcggtgcggatactctgaatgtagaagctatcagtaatgccatc
accctgaatgcaggtgcaggtaatgatgtgattaatgtgggtagtgccacaacaccaaca
gtcaacggcatagcagccgctttaaccatcaatggtggcactgaaactgacaccgtcaac
atcaatgacaatggcgacaccgcagccaatacaggcacattaaccagcagcacaattact
ggtttaagtcccagcactatcacttacggcacagtagaaactctcaacattaatctgggc
gcaggtgcagatagctttactgtcagcagcagcagtgcaacaaccacgattaatgcaggt
ggcggtgcggatactttgaatgtactagcgatcgctaatgccacaaccctgaatgccgat
gcaggtaatgatgtgattaatgttggaactgccggaacactagcagccaatggcatagca
gccgctttaaccatcaatggtggtagtgaaactgacaccatcactatcaatgacagtggt
gataccgcagccaacacaggcacattaacgtccaccacaattactggtttaagtagcggt
accatcacttacggcacagcagaaactctcaacattaatctgggtacaggtgcagatacc
ttgactgtcagcagtaccggtgctgcaaccacgattaatgcaaatggcggtaatgatact
ctcaatgtacaagcgatcgctaatgccacaaccctgaatgccgatgcaggtgatgatgtg
attaatgttggtggtggcacaccaaatactgtcaatgctatcgctgctgctctcaccatc
aatggcggtgctgacactgacaccatcaccatcaatgacagtggcgacactgctaacaat
acaggtacactcacagccacagccctcacaggcttgggtagcaatggcatcacttatggc
acagtagaaactctaaatatcaacctcggtagtggctcaaataacttaactgtacaggga
gttagtgcagctaccaccattacaggtggatcaggcaatgacacaattaatgcctcggct
attaaccaagcgatcgccatttatggtaatgctggtaacgataacattaccggcggtgga
ggtaatgataccctcgacagtggtactggtgaagatacggtgactgcgggcggaggaaat
gacttaatttacgtccagggaactagcggtgcaggcacaacaattaatggagatgcaggt
aatgatgtaattaatattggtagtagcacatcaaatactgtcaatacgattgctgcggct
ttaaccatcaatggtggtaatggtattgatactgtaaacatcaatgacagtggcgacaca
gcagccaatacaggcacattaaccagcactgcaattactggtttaagtcccgctaccatc
acctacggcacagtagaaactctcaacattaatctgggtgcaggtgcagatactttgact
gtcagcagtaccagtgccacaaccacggttaacgcaggtggcggtaatgacactctgaat
gtactagcgatcgctaatgccacaaccctgaatgcagatgcaggtaatgatgtaattaat
gtgggtagtgctgaagcaacaatactcaatgtcatagcatctgatttaaccatcaatggt
ggtgataatgctgacaccatcaacatcaataatagtgctaatactgctaacaattcaggc
ggattaagcagcaccactattgatggtttgggtctccgtcgtcctatcaattacagcaca
gtagaaactctcaacattaatttgggtacaggtgcagatcgctttactatcagcagtacc
ggtgctgtaaccacaattaacacaggtggtggtaatgatactgtgaatgtagaagcgatc
agtcatgccacaaccctgaatacaggtgcaggtaatgatgagattaatgttggtaatcgc
ggactaagaacagtcaatgacatagcagccgctttaaccatcaatggtggtgctgatact
gacaccgtaaggattaatgacacagacgacaatacaaacaatacaggcacattaaccgcc
actacaattactggtttaagtcccactaccatcacctacggcacagtagaaactctcaac
attgagttgggtaggggtgcagatacctttactgtcagcagtaccagtgcaacgactacc
attaatgcaggtgacggtgcggatactctgaatgtacaagcaatcactaatgccacaacc
ctgaatgcaggtacaggtaataatgtcattaatgttgcgagtgctggaacaccgacagtc
aatggcatagcagctgctttaaccatcaatggtgggccagagaacaatagcctcgaagtt
agggatagcggtgataccacagctaatacaggtacattaactgatactcagttgacagga
ttaggtatgacaggtggaatcacttatcgagaaatcaccaatttaagtatcagattaggt
agtggtaacaacaactttactattgccagtacatttcctcgtactacaacctcgatttat
ggtaatgtaggagcagaaacctttaatgtgcgctctatccgtagcagtaccaacatattt
gctgccggtggcaacgataccatcaatgtcagcacttctgcaccaaacggcggaggtata
gttaacgaaattttagctctactcttcgtcgatggcggtgctggtggtgatactttaaac
gtagatgatagaggtgatggcgcgcctaacaacggcacaatgaccgccaacactatcaca
ggcttaggtatgagtaatggcatcagctacacactcttagaagcgaccaatattttactc
ggttctggtaatgatattttcactatcaacagcaaaataccaggtagtagcatcctagtt
gatggcggtcctggaattgacttgatctttgatttcaccttctcagcaatcgtccgcaat
gcctaa

DBGET integrated database retrieval system