KEGG   Anabaena variabilis: Ava_4198Help
Entry
Ava_4198          CDS       T00277                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ava  Anabaena variabilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ava_4198
Enzymes [BR:ava01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Ava_4198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5257970..5260552
Genome map
AA seq 860 aa AA seqDB search
MMIFTLKIASLTFWKSIHLRLNFTHSKKQFIHMKRWLLANLIALCSFLFLGTNAAWAVGG
GIAPGAPGVSSVWSYAGKQGIGTSYEQYVDNKYSDRAPTNAISKVWFSIAQGIVTETAYG
EIDRAQINDLQFLVTGNGFFDEEKVSTTSKVDYLDKDKDGRPLSPAYRVINKDKDGKYTI
EKHIFTDPDHQTLFTKVIFTAKEDNVTPYILINPHMNNTGKEDVAFVKSDSLNAREGEIV
YLSLKSSLPFVKTSAGYVARSDGYQDLKDNGVMDWTYDYTDQSKPGSVAMIGQLPTLNKG
QTSTFNIAVGFGSTYQEATEQVDASLKEGYESLLAKYNGKGSAVGWEDYLASLKNLPAMI
ANTGDKGKQLYASAFTLKSMEDKENPGALIASLSVPWGDTVNADTFATGYRAVWPRDFYQ
AAMALLALGDKETPLTAFKYLPQVQVQSDTPGNAGATGWFLQKTHVDGTLEWLGVQLDQT
AMPIMLGWKLWKAGVLSDGEITEQYRTMLKPAAEFLANGGNVNIHTSDQANNRKINPPST
HQERWEEQSGYSPSTTAAIITGLVAAGDIAENAADDPLAAKYYFSKADEYQKNVDKFMFT
TTGDIKNCNSSSEYLLRVTPNADPNDGSRIHDNNSLLEADERQILDGGFLELVRYGVRKG
DDAHIAASVCALDNISLSEDLRVRYDIPFDGKKYPGFRRYGNDGYGEQINDGSNFRDIDD
GQKKLRRGRIWPFFTGERGHYELELAKAKNGGTISDQDVAKLRDTYVRAMEYFANESLML
PEQVWDGVGENKAHNYITGEGTNSATPLAWAHAEYIKLVKSLTDKNVWDSYPIVQARYQS
SESLTASSSHPNGTKISANP
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcttcactctcaaaattgcatcacttactttctggaagtctattcatctccgt
ctcaattttactcactcaaaaaaacaattcattcatatgaaacgttggttattagctaac
ttaattgctctttgctcgtttttgttcttaggaacaaacgctgcttgggcagtcggtggt
ggcattgcgccgggcgcaccgggtgtttcctctgtttggtcttatgctggtaagcaaggc
attggaacatcctatgaacagtatgtggataataaatatagcgatcgcgctcctacaaat
gccatctccaaggtttggttttcaattgctcaaggtattgtgacagaaaccgcctatgga
gaaatcgatcgcgcccagatcaatgacttacaattcttagtcacaggcaacggttttttt
gatgaagagaaggtttctaccaccagtaaggtggactatctagataaagataaggatgga
aggcctctttctcctgcttatcgtgtgatcaataaagataaagatggtaaatacaccatt
gaaaagcacatctttaccgatcctgatcaccaaactttgtttacaaaagtgatctttact
gccaaagaggataacgttaccccctacattctgattaatcctcacatgaataatactggc
aaagaagatgtagcttttgttaaaagcgatagtctcaatgctagggaaggagaaattgtt
tatctaagtttgaagagttcattgccttttgtgaaaacctcagccggatacgtagctcgt
agtgatggctatcaagatttaaaagacaatggggtgatggactggacttatgactacact
gatcagagcaagccggggagtgtagctatgataggtcaactgcctaccctcaataaagga
caaacttccacctttaacattgctgtaggctttggcagcacctatcaagaagcaaccgaa
caagtcgatgcttctttaaaagaagggtacgaaagtctgttagcaaaatacaacggtaaa
ggcagcgccgtaggctgggaagattatctagccagtcttaaaaatctacctgccatgatt
gccaacaccggtgacaagggtaaacagctttatgccagtgctttcaccctcaagagtatg
gaagataaagaaaatcctggggctttaattgcttctttatccgttccttggggagatact
gtgaacgcagacacatttgccacaggctatcgagcagtttggccgagagacttttatcaa
gcagctatggctttgttagctttaggagataaagaaactcccctaacggcttttaaatac
cttccacaagtgcaagtgcaatcagatacaccaggtaacgctggggctacaggctggttt
ttacaaaaaactcacgttgatggaaccttagaatggctgggagtgcagttagatcaaact
gccatgccgattatgttgggctggaaactttggaaagccggagtgttgtcggatggtgaa
atcactgagcaatatcgcacgatgttgaaacctgccgcagaatttctggctaatggcggt
aatgtcaatatacatacctctgatcaagcaaacaaccgcaagataaacccaccaagcact
catcaagaacgatgggaagaacaatcaggatattccccctctacaacggctgcgattatt
actgggttagttgcggcgggtgatattgctgaaaatgcagctgatgatcctcttgcagca
aaatattatttcagtaaagcagatgaatatcaaaagaatgtggataaatttatgtttacc
acaactggagatattaagaactgtaatagctccagtgaatatctcctgagagttacccct
aatgcagatcctaacgatggaagtcgcatccacgacaacaatagtttgctggaagcggat
gaacgccagattttagatggtggtttcttggaattggtacgttatggagtcagaaaggga
gatgatgctcacattgctgccagtgtttgcgccttggataatatcagcctctcagaagat
ttaagggtgaggtacgacataccttttgatgggaaaaagtatccaggattccgacgctat
ggcaatgatggctatggtgaacaaatcaacgatggtagtaactttcgggatattgacgat
ggccagaaaaaactccgcagaggtaggatttggccgttcttcactggtgagcgtggtcat
tatgaacttgagttagctaaggccaaaaatggaggcactattagcgatcaagatgttgct
aaactacgtgatacttatgtacgagcaatggaatattttgctaacgaaagtctcatgctt
cctgaacaagtatgggatggtgttggcgagaataaggctcataattacatcactggagaa
ggaacgaatagcgccacacctttagcttgggcgcacgccgaatatattaagttagtcaaa
tcattgactgataagaatgtttgggattcctaccccattgttcaggcaagataccaatct
tcggaatctcttactgcctcaagttctcatccgaacggcactaagatcagcgcaaatcct
taa

DBGET integrated database retrieval system