KEGG   Trichormus variabilis: Ava_4204Help
Entry
Ava_4204          CDS       T00277                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ava  Trichormus variabilis
Pathway
ava00340  Histidine metabolism
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
ava01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Ava_4204
Enzymes [BR:ava01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Ava_4204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABA23803
JGI: Ava4204
CyanoBase: Ava_4204
CYORF: Ava_4204
UniProt: Q3M5D3
Position
complement(5265756..5267057)
Genome map
AA seq 433 aa AA seqDB search
MLRIITQQADVKAELQRICDRTHDEQVLHKEATVREVLQAVKRQGDKAVLHYTDEFDNQI
LKAEELRVTGSELDAAYQQVSKELLEAIQLASRQIEAFHRQRVPKSWVHFGDDDIVLGKR
YTPVDRAGLYVPGGRAAYVSTVLMNAIPAKVAGVPRIVMATPPGAQKAINPAVLVAAQEV
GVQEIYRVGGAQAIAALAYGTETIPKVDVITGPGNIYVTLAKKLVYGTVGIDSLAGPSEV
LIIADEGANPVHVATDMLAQAEHDPMAAAILFTTDPALAKNVQVAVERQLVDHPRRIDTE
KAIAHYGLIVLVESLDAAAELSNEFAPEHLELEVKDPWAVLPNIRHAGAIFLGYSTPEAV
GDYLAGPNHTLPTSGAARYASALSVETFLKHSSIIQYSQTALNKVAGAIDALATAEGLPS
HADSVKRRIQQDE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaatcattactcagcaggcagatgttaaagcagaactgcaaagaatctgcgat
cgcactcacgacgaacaggtgcttcacaaggaagcaactgtgcgggaagtgttgcaagca
gtgaaacgccaaggcgacaaagctgttttgcattacacagatgaatttgacaatcaaatt
ctcaaagctgaagagttacgcgttacaggttcagaactggacgcagcttaccaacaggta
tccaaggaactgctggaggcgattcagctagctagccgccaaattgaagcttttcatcgt
cagcgagtccccaaaagctgggtacactttggcgatgatgatattgtactgggcaaacgc
tacactcctgtagaccgtgcgggtttgtatgttcctggtggtcgtgctgcttacgtcagt
acagtgctgatgaacgcaattccggcgaaggtggctggtgtaccgcgtatagtaatggcg
acaccaccaggcgcacagaaagcgattaatcccgcagtgttagtagcagctcaagaagtg
ggagtacaagaaatttatcgggtaggtggggcgcaagcgatcgctgctttagcctatggt
acagagacaatccccaaggtggatgtaattactggccctggtaacatctatgtcactttg
gcgaaaaaactggtttacggcactgtggggatcgattccttagccgggcctagtgaagtg
ctgattattgccgatgaaggagcaaatcccgtccatgtagccactgatatgctggcacag
gcggaacacgatccaatggcggcggcaattttgttcaccacagacccagctctagcgaag
aatgtgcaagtagcagtggaaagacaattggtagatcatccacggcggatagataccgaa
aaagcgatcgctcattacggtttaatcgtgttggtagaatccctagatgcagccgcagaa
ctctccaatgaatttgcaccagaacacctagagttagaagttaaagatccttgggctgta
ttacccaacattcgccatgctggtgctatcttcctcggttattccacaccagaagcagta
ggggactatctagccggccccaaccatactttacctacatctggtgctgcccgttatgcc
tctgccttaagtgtagaaactttcctcaaacattccagcatcattcagtattcccaaact
gcactcaataaggtagctggagccattgacgctttagccacagccgagggcttaccctct
cacgctgactcagtgaagcggcgaattcagcaagatgaatga

DBGET integrated database retrieval system