KEGG   Anabaena variabilis: Ava_4264Help
Entry
Ava_4264          CDS       T00277                                 

Definition
(RefSeq) transketolase, central region (EC:4.1.2.9)
Organism
ava  Anabaena variabilis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5343242..5345455)
Genome map
AA seq 737 aa AA seqDB search
MTAITPKASSALPEFAEGIQYFGEALPDFETYGATPAIESGKVAIAAPTNPQAVYQTLLA
ADALRYLTLQITGSKASGHPGGFASQAEAYAALVMLGYKNIITEVGHHAPGFYSAMFLDR
SLEDMGISTVQQLRDRFREKHGLLGHLSGYIPGILAPAGPLGQGQHFAMAAALLHRDKLF
PFTLGDGGLGEPYIMSSMAHFNTAYPSVTNFLPVLVWNGYSQEHHSMVSLKTNAQMTAYW
QGNGFEEVVLVDAKEFDDQNQPGDYVDSTIFSFTQRLAFTQAVLVAVDKAARSALGGKLT
VFIIKQLKGAGVHAKGAKSHNLYPKDTLDAPHIITALQKRALSPAAWQTVRTNAERAGGG
PASKTVVTEFELPLPDLGTLPLEEYAVGGEPKVSTTAMGRIVGAVGQKDPNFLVTNADGN
EASGIGNINQALKIIHPTTDDLYNQAPNGQVYEPLSEDACAGLAVGLSLMGARTLWCSYE
SFAINGLPIWQTVIQAMAELRRPTPSTITLFTAGALEQGRNGWTHQRPEIEAYFASMMRN
GNVFPVFPPDANSTQVCYDWALTTKNKGIVITASKSPLPIRTTFAQTRQGLEEGAVVLHE
IPGGKQVVFAVIGDMTLIPVFEAAAFLETEGIGVKIVSVINPRRLYRPHDVAWDTCSEAD
NGFIDDAKFAELFAGDALIGVTGGVASMLEPIMLRSNSKRDTFAWKRGETTASAGELMAF
NGLTAEALTKRAIELVH
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaatcacacccaaagcttcgtcagcgcttcccgaatttgcggaaggtattcaa
tattttggtgaagcactaccagattttgaaacttatggtgccacacctgcgatagaatcg
ggaaaagtagcgatcgccgctccaacaaaccctcaagctgtatatcaaactttactcgcg
gctgatgccttacgctacctgacactacaaatcactggtagtaaggcttctggacatcca
ggcgggtttgctagccaagcggaagcttacgcggctttggtcatgctggggtataaaaat
attattaccgaagtcggacaccatgcccctggattttatagtgccatgttcctcgatcgc
tccttggaggatatgggtatctccacagtacaacaattgcgcgatcgcttccgcgaaaaa
catggattattaggacacctttccggttacatccccggtattcttgcacccgccggcccc
ttgggacaaggacagcactttgcaatggcggctgcactcctccaccgtgacaaacttttc
cccttcaccctcggcgacggtggactaggtgaaccatacatcatgagttcaatggcgcac
tttaacaccgcctatcccagcgtcaccaacttcttacccgtgttggtgtggaatggttac
agccaagaacatcacagcatggtttccctcaaaaccaacgcacagatgacagcatattgg
caaggtaacggttttgaagaagtcgtattagttgatgccaaagaatttgacgaccaaaac
caaccaggagattatgttgacagtaccattttctcctttacccagcgtctagccttcacc
caagccgtcctcgtcgccgtagataaagccgcccgttccgccctgggtggtaaactgaca
gtcttcatcatcaaacaactcaaaggcgcaggcgttcacgccaagggtgcaaaatctcac
aacctctatcccaaagacaccctagacgcaccccatattatcaccgccttacaaaaacgg
gcattatcccccgcagcttggcaaaccgtcagaaccaacgccgaacgcgcagggggaggc
ccagcatctaaaacagtggtgacagaatttgagttaccattaccagatttaggtacatta
ccattagaagaatatgcagtcggtggtgaacccaaagtttctaccaccgcaatgggacga
atcgtcggtgcagttggacaaaaagatcccaatttcctcgtcactaacgctgacggaaac
gaagcatcaggtataggtaacatcaaccaagccttaaagattatccaccccaccaccgac
gacttatataaccaagcaccaaacggacaagtttacgaaccattgagtgaagatgcttgt
gcaggtttagctgttggtttgtctttgatgggtgcaagaaccctctggtgttcttacgaa
tctttcgccatcaacggcttaccaatctggcaaaccgtcatccaagcaatggcagaatta
cgccgcccaactccctcaacaattaccttattcaccgccggcgcactagaacaaggacgc
aacggctggacacaccaacgtccagaaatcgaagcttactttgcatccatgatgcggaac
ggcaatgtattccccgtattcccccccgatgctaacagtacccaagtttgttatgactgg
gcgttgacaactaagaataaaggcattgtcatcaccgccagtaaatcacccttaccaatt
cgtaccacctttgcccaaactcgccaaggtttagaagaaggtgcagtagtattgcatgaa
attcctggtggtaagcaagttgtgtttgctgtcattggcgacatgacattaattcccgta
tttgaagccgccgctttcttagaaactgaaggtatcggagtgaagatagtttctgtgatt
aatccccgccgtttgtatcgtcctcatgatgttgcatgggatacctgttctgaagctgat
aacggtttcattgatgatgccaaattcgctgaattatttgctggcgatgccttaattggt
gtcactggtggtgtggcttcgatgttagaacctatcatgttgcggagtaacagcaagcgc
gataccttcgcctggaagcgtggggagactacagctagtgctggtgagttgatggcgttt
aatgggttgactgctgaggctttgacaaagcgggctattgagttagtgcattaa

DBGET integrated database retrieval system