KEGG   Anabaena variabilis: Ava_4293Help
Entry
Ava_4293          CDS       T00277                                 

Definition
response regulator receiver domain-containing protein (EC:3.1.1.61)
Organism
ava  Anabaena variabilis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5380076..5380498
Genome map
AA seq 140 aa AA seqDB search
MTVHLLTKSHQFHLQPLKRILIVEDNDINRMLLSDYLSYSGYHVQSLSDGSNFFKTIEKF
QPDLILLDLKLPDVDGYYLLEQIQQQQEFARIPVIVVSGFAFKVDQKRAIDLGARGYFVK
PINLNALLIKISQELVVNCI
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgacagtacatttactgacaaaatctcatcaatttcatttgcagcctctaaaacggatc
ttaattgtcgaagataatgatatcaataggatgttattaagtgattatctgagttatagc
ggatatcatgttcaaagtttatcggatggctccaattttttcaaaaccatagagaaattt
cagcctgacttgattttgttggacttgaaattaccagatgttgatggatactatttactt
gagcaaatccagcaacagcaggaatttgccaggataccagttattgttgtttcaggtttt
gcttttaaagttgatcaaaaaagagctatcgatttgggcgctcgtggttactttgttaaa
cctataaatctgaatgctttgcttataaaaatttctcaggaattagttgttaattgcata
tag

DBGET integrated database retrieval system