KEGG   Trichormus variabilis: Ava_4339Help
Entry
Ava_4339          CDS       T00277                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ava  Trichormus variabilis
Pathway
ava00010  Glycolysis / Gluconeogenesis
ava00052  Galactose metabolism
ava00500  Starch and sucrose metabolism
ava00520  Amino sugar and nucleotide sugar metabolism
ava00521  Streptomycin biosynthesis
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
ava01120  Microbial metabolism in diverse environments
ava01130  Biosynthesis of antibiotics
ava01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ava_4339
   00052 Galactose metabolism
    Ava_4339
   00500 Starch and sucrose metabolism
    Ava_4339
   00520 Amino sugar and nucleotide sugar metabolism
    Ava_4339
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ava_4339
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Ava_4339
Enzymes [BR:ava01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ava_4339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABA23937
JGI: Ava4339
CyanoBase: Ava_4339
CYORF: Ava_4339
UniProt: Q3M4Z9
Position
complement(5441651..5442601)
Genome map
AA seq 316 aa AA seqDB search
MKLTLALDFGGTKLAAGLVNADSRKWLRYERRFSPINGDANTDLEIMRSLIHSLLQGETP
TAIGVSFGGPVDATTGTVRLSHHVPGWENIPLKSLLEKEFGVPTSVDNDANVAALGEQHF
GAGQGYDSLFYITISTGVGGGWILNGKPWRGAVGMAGEIGHIVVEPAGPICLCGKRGCVE
RLASGPYMAQNAKDILENQPEREDGQILRNLVGNNLNLLTGQLISEAATKGDNLAQAVLQ
KSAWALGVGIGNVANLINPQRFILGGSVTKAGEIWWTVLQETARFTALPEVPLEIVPAVL
ADDAPLWGAVALAQNL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaactttagcgctggattttgggggaacgaagctagcagcagggttagtaaat
gctgattctagaaaatggttgcgttatgaacgtcgcttttccccaatcaatggagatgct
aacacagacttggaaattatgcgatcgctcattcattccttactccaaggtgaaactccc
accgccattggtgtcagcttcggcggccccgtagacgcaaccaccgggactgtcagacta
tctcatcacgtccctggttgggaaaatattcccctaaaaagcttgctagagaaagagttt
ggtgtccctactagtgtagacaatgatgccaacgttgcggctttgggtgaacagcacttt
ggtgcaggtcaaggatacgatagcctgttttacattaccatcagcaccggtgtgggtggc
gggtggatactcaacggtaaaccttggcggggtgcagttggcatggctggtgaaattggc
catatagttgtagaacctgctgggcctatatgtttatgtggtaagcgtggatgcgtagaa
cgtttagcatcagggccctacatggcgcaaaatgctaaagatattttagaaaatcaacca
gaacgggaagacggacaaatactcagaaatttggtagggaataacttaaatttacttaca
ggtcaactaatcagcgaagcggctacaaaaggagataatctagctcaagctgttttgcaa
aaatccgcttgggccttaggtgtaggtatcggtaatgtagccaatctcattaacccccaa
cgttttattttaggtggtagcgtcaccaaagcaggggaaatttggtggactgtattacaa
gaaacagccaggttcacagcattaccagaagtaccattggaaatcgtgccagcagtatta
gccgatgatgcaccattatggggtgctgtagctttagcccaaaatctttaa

DBGET integrated database retrieval system