KEGG   Anabaena variabilis: Ava_4421Help
Entry
Ava_4421          CDS       T00277                                 

Definition
glycoside hydrolase family protein (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ava  Anabaena variabilis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5536855..5537586
Genome map
AA seq 243 aa AA seqDB search
MSITETLRKGSKGSEVSELQEILVKLKFDPGRIDGDFGNKTEAAVKQFQQKQNITPDGVV
EINTRNALNKAIQRQIEIAKLYGGASGKLPLPGVNLIKEFEGCKLIAYPDPLSKGKPYTI
GWGSTVKKDGSEWSLGEKITQVEADELLIFQLERKYLPPLERILRWEDFNPYQQGALLSF
AYNLGANFYGSKGFETITRVLNNQEWDKIEPTLIMYRNPGSPVEAGLRRRRVAEAKLFLQ
PLS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcaccgagacgctcagaaaagggtcaaaaggctcagaggtgagcgaactgcaa
gaaatactagttaaactaaaattcgatccaggtcggatagatggtgatttcggtaacaaa
acagaagcggctgtcaaacaattccaacaaaaacaaaatattactcctgatggcgtagta
gagataaatactcgtaatgctttaaataaagccattcagcgacaaatagaaatagcaaaa
ctttatggtggagcttccggtaaattaccactaccaggggtgaatttgatcaaagaattt
gagggctgtaagttgatagcttatcccgaccctctctctaaaggtaaaccttatactatt
ggttggggttctactgtaaaaaaagatggtagcgaatggtctttgggggaaaaaattacc
caagtagaggcggatgaactgttaatttttcagttagagcgtaaatatttaccacctcta
gagagaatacttagatgggaagatttcaatccttaccaacaaggagcattattgagtttt
gcttataacttgggggcaaatttctatggttctaaaggttttgagacaattactagagta
ttgaataatcaagagtgggacaaaattgaacccactctaattatgtatagaaatccgggt
agtccagttgaggcggggttaagacgcagacgagtggctgaggctaaactatttcttcag
ccattgtcatag

DBGET integrated database retrieval system