KEGG   Anabaena variabilis: Ava_4479Help
Entry
Ava_4479          CDS       T00277                                 

Definition
glycoside hydrolase family protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ava  Anabaena variabilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ava_4479
Enzymes [BR:ava01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Ava_4479
Exosome [BR:ava04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ava_4479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5610169..5611827)
Genome map
AA seq 552 aa AA seqDB search
MAKPIEFTLFAPYNKGAALIASFSDWQEIPMQKGDDGYFRATIELEDGTYQYKFRVQTRS
WFFEEDQWVDVTDPYATDIDESSGKDNGIIKIKDGEKIVDTYVWQHDDKPLPADHELVIY
ELHVGDFSGGEDDLYARGKYKHVIEKLDYLCELGINAIELLPVKEYPGDYSWGYNPRYFF
ATESSYGSTADLKKLVDECHQRGIRIIMDGIYNHSEASSPLTQIDHDYWYHHEPRDPDNN
WGPEFNYEHYDENLETYPARKFIGDTVRYWVGEYHLDGIRYDAARQIANYDFMHWIAQEA
KKTAGAKPFYNVAEHIPETTSITNLDGPMDGCWHDSFYHTIKAHICGDTFDLESLKDVID
PKRQGFLGATNVVNYLTNHDHDHIMVELGNREIFHDEAFRRAKLGTAILMTAVGVPLIWM
GEEFGEYKPKQQDQSKIDWTLLGNDLNRSLFDYYRGLIGLRKNNHALYTENIDFIHENPE
AKVLAYSRWNDEGSRVVVVTNFSEDFLAGYHVPNFPSGGTWHEWTGDYDVEAGDDGIITD
IGPYEAKVFVWQ
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcccattgaatttaccttatttgcaccctataacaaaggagcagcattaatt
gcctcattttccgattggcaagaaattcctatgcaaaaaggtgatgatggttattttcgc
gcaactattgaattagaagatggtacatatcaatataaatttcgtgtacaaacaagatca
tggttttttgaagaagatcaatgggtagatgttacagacccttatgctactgatattgat
gaatcaagtggtaaagataatggcatcatcaaaataaaagatggtgaaaaaattgttgat
acatatgtttggcaacatgatgataaacctttacctgctgaccacgaattagttatttat
gaattacacgtaggtgacttttctggtggagaagatgacctttatgcacggggcaaatat
aaacacgttattgaaaagttagattatttgtgtgaattgggcatcaatgccattgagttg
ttaccagtaaaagaatatccaggtgattatagttggggttataatcctcgctatttcttt
gctactgaatccagctatggttctacagctgatttaaaaaaattggttgatgaatgccat
caacgaggtattcgcatcattatggacgggatttataaccactccgaagcatccagtcca
ttaacacaaattgaccatgactactggtatcaccatgaaccacgcgaccctgataataac
tgggggccagagtttaattacgaacactatgatgaaaatttagagacttatccagcaaga
aaatttattggtgatactgtcagatattgggtcggagaatatcatctagatggtattcgc
tacgatgcagcaaggcaaatagccaactacgatttcatgcactggattgctcaagaagca
aagaaaactgccggagcaaaaccattctataatgttgctgaacacatcccagaaaccact
agcattactaatttagatgggccgatggatggatgttggcatgatagtttttaccacacc
attaaagctcatatatgcggtgacacctttgatttagaaagtctcaaagatgtcattgac
cctaaacgccaaggtttcttgggtgcaactaatgttgtgaactatctcaccaaccatgac
catgaccatatcatggtggagctaggtaatcgagaaatttttcacgacgaagcttttaga
agagctaaactgggaactgcaattttaatgacagctgttggtgtacctttgatttggatg
ggagaagaattcggcgagtataaacccaaacaacaagaccaatctaaaattgattggaca
ctcttaggtaatgatctcaatcgtagtttgtttgattactacagaggattgataggttta
cgtaagaataatcacgcgttgtatacagaaaatattgatttcatccacgaaaatccagaa
gccaaggtgttagcctacagccgttggaatgatgaaggttctcgtgtggtagtggtgacg
aatttctccgaagacttcctcgccggttatcatgtccctaatttcccctctggtggtaca
tggcatgagtggactggcgactatgatgttgaagctggtgatgatggtatcatcactgat
atcgggccttatgaagctaaggtatttgtttggcagtaa

DBGET integrated database retrieval system