KEGG   Anabaena variabilis: Ava_4482Help
Entry
Ava_4482          CDS       T00277                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ava  Anabaena variabilis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Ava_4482
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ava_4482
  Lipid metabolism
   00071 Fatty acid degradation
    Ava_4482
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ava_4482
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ava_4482
   00626 Naphthalene degradation
    Ava_4482
Enzymes [BR:ava01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ava_4482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5612960..5613946)
Genome map
AA seq 328 aa AA seqDB search
MRAMILDAPRQPLRLTELPIPRPNSEQVLIRVHACAVCRTDLHIVDGELTHPKLPLILGH
QIVGTIEALGEKVDQFHLGQRVGVPWLGHTCAHCPYCLSGRENLCDYAEFTGYNIDGGYA
DYTVADHHFCFPLDPTYPDLQAAPLLCGGLIGYRAYNMTGDAEKLGFYGFGSSAHILIQL
ARYQGRKVFAFTRPGDIDGQEFARQLGANWAGDSDVLPPESLDAAIIFAPVGKLVPTALR
AVAKGGVVVCAGIHMSDIPSFPYSILWEERVLRSVANLTRQDGEEFLTIAPQIPIRTKIN
SFPLTQANEALDALRSGKIEGSAVLVMK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccatgattttagacgcaccgcgtcaacccttacgcctgacagagttaccaata
ccaagacctaattctgagcaagtattgattcgcgttcatgcttgcgccgtctgtcgcact
gatttacatatagtggatggagaattgacacacccaaaactacctttgattttgggacat
caaattgtagggacgattgaggctttaggggaaaaagttgatcaatttcatctaggtcaa
agggttggtgtaccttggttgggtcatacttgcgctcattgtccttactgtctctctggg
cgggaaaacctctgtgattatgctgaatttacaggttataatatagacggcggctatgca
gactatacagtagctgaccaccacttttgttttcctttagaccccacttatccagactta
caagctgcacctctgttatgtggcggtttaattggctaccgggcttacaatatgactgga
gatgctgagaaactcggtttttacggtttcggttcctctgctcatatcttaattcagtta
gcacgttatcaagggcgcaaagtatttgctttcactcgtcctggggatattgatgggcaa
gaatttgcccgtcaattaggtgcaaattgggctggtgactcagatgtattaccgccagaa
tctttagatgcagcaattatttttgcaccagtggggaaactagttcctaccgccttgcgt
gcagttgctaaaggtggtgtagtcgtttgtgctggtattcatatgagcgatatcccctca
tttccctacagcattctttgggaagaacgggtgttaaggtctgtagctaatttaacacgc
caagatggcgaagagtttctgactatcgcgccgcaaattcccatccggacaaagattaat
tctttccccttgactcaagctaatgaggctttagatgcgctacgtagtggcaaaatagag
gggtctgctgttttagtgatgaagtga

DBGET integrated database retrieval system