KEGG   Anabaena variabilis: Ava_4616Help
Entry
Ava_4616          CDS       T00277                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ava  Anabaena variabilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ava00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5773719..5776013)
Genome map
AA seq 764 aa AA seqDB search
MPMTTIAPEQVNRIVWNQHHDPFEILGSHPIEQNGKNVWVVRAYLPNASAAWVVLPEQRQ
EYAMQTVHDPHFFECIIETSELSNYQLKTKEGEHERVSYDPYAFRSPRLTDFDLHLFAEG
NHHRIYEKLGAHFTEVDGVTGVYFAVWAPNARNVSVLGDFNLWDGRKHQMRKGATGVWEL
FIPEIGVGEHYKYEIKNFAGHIYEKSDPFGFQQEPRPKTASIVSNLNSYNWSDENWLEQR
RHTDPLTQPISVYEVHLGSWLHAASAEPAKLPNGETEPVVIASELNPGARFLTYRELASR
LIPYVKELGYTHIELLPIAEHPFDGSWGYQVTGYYAPTSRFGTPEDFMYFVDQCHQNNIG
VIVDWVPGHFPKDGHGLAFFDGTHLYEHADSRKGEHKEWGTLVFNYSRNEVRNFLVANAL
FWFDKYHIDGIRVDAVASMLYLDYCRKEGEWLPNQYGGRENLEAADFLRQVNHLLFSYFP
GVLSIAEESTDWPMVSWPTYTGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNVTFSM
WYNHSENFMLALSHDEVVHGKSNIIGKMPGDKWQKLANVRCLFAYMFAHPGKKTMFMSME
FGQWSEWNVWADLEWPLLQFEPHQQLKKFFTELNKLYRSEPALYTLDFAREGFDWIDCSD
NRHSVVSFIRREKDTENFVVVVCNFTPQPHSHYRIGVPEKGFYTELFNSDARQYGGSNMG
NLGGKWTDDWSMHSRPYSLDLCLPPLGVLILKMDKEKTAKASGS
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgaccacgatcgctcctgaacaggttaaccgcatcgtctggaaccagcatcat
gatccttttgaaatcctcggttctcatcccatagaacaaaacggcaaaaacgtttgggtt
gtgagagcctacctaccaaatgccagtgcagcatgggtcgttcttccagaacaacggcaa
gaatacgccatgcagacggtgcatgatccacacttttttgaatgtattattgaaacttcc
gaactatcaaactaccagttaaaaactaaagaaggagaacatgagcgtgtttcctacgat
ccttacgcttttcgttcccctcgtttaacagactttgacttacatttgtttgctgaaggt
aatcaccatcgcatttacgaaaaactgggagcgcatttcacagaagtagatggcgttaca
ggtgtttactttgcagtctgggcccccaatgctcgaaatgtctctgttttgggagatttc
aacctctgggatggacgtaaacatcagatgcgtaaaggcgctactggcgtttgggaatta
ttcattcccgaaatcggggtaggggagcattacaaatacgaaatcaaaaattttgcaggg
catatttatgaaaaatccgaccccttcggttttcaacaagaaccccgccccaaaacagcc
tcaattgttagtaacttaaattcatacaactggagtgacgaaaactggttagaacagcgc
cgtcatacagatcctttaacccagccgatttcagtttatgaagtacacctgggttcttgg
ttacacgctgctagtgcagaaccagctaaactacctaatggtgaaactgagcctgtagtc
attgcttcagaactcaatccaggcgcacgttttttaacatatcgggaactagccagcaga
ctcattccctatgttaaagaactaggatatacccacatagaattattaccaatcgccgaa
catccttttgatgggtcttggggttatcaggtaacaggatactacgcccctacttcgcgt
tttgggactcctgaagactttatgtattttgttgatcagtgtcaccaaaacaacatcggt
gtaattgtcgattgggttcctggtcacttccccaaggatgggcatggtttagccttcttt
gatggtactcacctatatgaacacgccgactcccgtaaaggtgaacataaagagtggggg
actctggttttcaattatagccggaacgaagtccgcaactttttggtagcaaatgccctg
ttctggtttgacaaataccacatagatggtattcgtgttgatgcggtggcttccatgctt
tatctcgactactgtcgcaaagagggcgaatggttgcctaaccagtacggtggtagagaa
aatctagaagcagcagattttctgcgtcaggtaaatcacttgctttttagctattttcct
ggtgtgctttccattgcggaagaatccacagattggccgatggtgtcttggcctacctac
acaggtggtttaggatttaacctcaagtggaacatgggctggatgcacgatatgctggat
tatttcagcatggacccttggtttaggcaattccaccaaaacaacgtcacctttagtatg
tggtataaccacagtgagaacttcatgctggctctatcccatgatgaagtcgtacatggt
aagagcaatatcatcggtaaaatgcctggtgataagtggcagaagttggcaaatgtgcgt
tgtctgtttgcctatatgtttgctcacccaggtaagaaaaccatgtttatgagcatggaa
tttgggcaatggagtgagtggaatgtttgggctgacttggagtggcctttgttacagttt
gaaccacaccaacagttgaaaaaattcttcactgaactgaataaactttaccgttctgaa
cctgctttatacactttagattttgctagagaagggtttgattggattgattgtagcgat
aatcgccacagcgtagtctcgtttattcgccgtgaaaaagatactgagaatttcgttgtg
gtggtttgtaacttcacaccccagcctcattctcattaccgtattggtgtcccagaaaaa
ggtttttacaccgagttattcaatagtgatgctcgtcagtatggcggtagcaacatgggt
aacttaggtggtaagtggactgatgattggtcgatgcacagtcgcccctattcactggat
ttatgtttaccacctctgggagttttgattttgaagatggataaggaaaaaacggctaaa
gcatcaggttcttaa

DBGET integrated database retrieval system