KEGG   Anabaena variabilis: Ava_4702Help
Entry
Ava_4702          CDS       T00277                                 

Definition
(GenBank) Response Regulator Receiver Signal Transduction Histidine Kinase (EC:3.1.1.61)
Organism
ava  Anabaena variabilis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5878222..5879367
Genome map
AA seq 381 aa AA seqDB search
MNLPSILVIDDLPDNFDVIETLLSEQDYTLHYVASGQEAIASLNLFQPDLILLDVMMPGM
DGIEVCQRIKAMPQWQSVPIIMVTALTAKEDLARCLKSGADDFISKPINALELRARLHSM
LRIKQQYDKIQTLSNIQTSTIKVLESTLDELRGNLAAALPHELNTPLNGIVGTISILMAD
IENMDTGEIQELLGWVDLSARNLERLIKQLLLYLELELSTNQQQNIASESTHFSIAVIEA
ILQSHAPSVNRRDDLMFAIEEAEVSISARYLAIIIYELVDNALKFSRRGTTIKISSQVVA
GMLNVYIHDFGRGMTEEQISKIGAFMQFERKTYEQQGIGMGLKLAKQIIESHGGLFSISS
VYKKETMVHIALPIAYSRYLS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgccctctattcttgtaattgacgatctaccagataactttgatgttattgaa
accctcttaagtgagcaagactatacactacattatgttgctagtggtcaagaggcgatc
gcctccctcaacctatttcagccagacctgattttgctagatgtgatgatgccgggaatg
gatgggatagaagtgtgtcagcgaattaaagccatgccccaatggcagtcagtgccgatc
attatggtaacagccctcaccgccaaagaagacctcgcacgctgcttaaaatctggtgcc
gatgacttcattagtaaacctatcaatgctctggagttgagggcgcgccttcattcaatg
ctgaggattaagcaacagtatgacaaaattcaaactttatcgaatatccaaacaagcacc
atcaaagtattggaaagtacacttgatgaactgcgcggcaatttagctgctgccttaccc
catgaactcaatacaccactaaatggtattgtcggaactatcagtatactcatggcagat
attgagaacatggacactggtgaaatccaggaacttttaggctgggtagatttatctgcc
cgtaacctagaaagattaatcaaacaattgctgctctatttagaactagaattatcaaca
aaccaacagcaaaacatcgcctctgagtcaacccacttttccatagcagtaattgaagca
attttacaatctcatgctccaagtgttaatcgccgcgacgatctcatgtttgcaattgag
gaagctgaagtgtcaatctcggctcgatatctagcgattatcatctatgaattagttgat
aatgcgctcaaattttcccggcgagggacaaccattaaaatcagtagtcaggtagtagca
ggaatgttaaatgtctacattcatgatttcggccggggtatgacagaagaacagatatct
aaaatcggcgctttcatgcagtttgaacgcaaaacttatgaacagcaaggtataggtatg
ggcttaaagcttgccaaacaaatcatcgaaagtcatgggggattgttctcaatttccagt
gtctataagaaggaaacaatggtacatattgctttacctattgcctattctagatactta
agttag

DBGET integrated database retrieval system