KEGG   Anabaena variabilis: Ava_4759Help
Entry
Ava_4759          CDS       T00277                                 

Definition
(RefSeq) nitroreductase (EC:1.6.99.3)
Organism
ava  Anabaena variabilis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5985969..5986634)
Genome map
AA seq 221 aa AA seqDB search
MSTITQIQPLDVPSAIVQRRSIKTFKTDPIAPELLKQLVDLTVAAPSSFNIQDWRIILVQ
DEAQKAALSAASWNQKQIIEAPVTFVFAADSSVGEGDLTPVFETALATGAWNEGTVNYFK
NAIPQFQAGLGDKRREYAIKDAIIAATHLVLAAESLGLSTCFMNGWIEDQVKEVIGAADN
PDLAIAVLVPVGYAAEPRLNPGRLPLSNNVSVDRIDNPYVG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccatcacccaaattcaaccgctagatgtacccagcgctatagttcaacgtcgc
tcgattaaaacttttaaaacagaccccattgccccagaattactcaaacaactagtagac
ttgactgtagccgcacccagtagctttaacattcaagattggcgaattattttagttcaa
gatgaggcgcaaaaagcagccctttctgccgcctcttggaaccaaaaacaaattatcgaa
gcacctgtaacttttgttttcgctgccgattccagcgtcggcgaaggagacttaaccccg
gtttttgaaacagcgttagccactggggcttggaatgaagggactgtgaattattttaaa
aatgctattccccaatttcaagcaggactgggagataagcgccgggaatatgcgattaaa
gatgccattattgctgctacccatttggtattagcagcagaaagtttaggcttatccacc
tgctttatgaacggctggattgaagaccaagtgaaagaagtaattggtgcggcggataat
cctgatttagcgatcgctgttttagttcctgtaggctatgcagcagaaccacgtttaaat
ccaggtcgtctgccattgtctaacaatgtctctgtagacagaattgataatccctatgta
ggttag

DBGET integrated database retrieval system