KEGG   Anabaena variabilis: Ava_4759Help
Entry
Ava_4759          CDS       T00277                                 

Definition
nitroreductase (EC:1.6.99.3)
Orthology
K00356  
NADH dehydrogenase [EC:1.6.99.3]
Organism
ava  Anabaena variabilis
Pathway
Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Ava_4759
Enzymes [BR:ava01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With other acceptors
    1.6.99.3  NADH dehydrogenase
     Ava_4759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5985969..5986634)
Genome map
AA seq 221 aa AA seqDB search
MSTITQIQPLDVPSAIVQRRSIKTFKTDPIAPELLKQLVDLTVAAPSSFNIQDWRIILVQ
DEAQKAALSAASWNQKQIIEAPVTFVFAADSSVGEGDLTPVFETALATGAWNEGTVNYFK
NAIPQFQAGLGDKRREYAIKDAIIAATHLVLAAESLGLSTCFMNGWIEDQVKEVIGAADN
PDLAIAVLVPVGYAAEPRLNPGRLPLSNNVSVDRIDNPYVG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccatcacccaaattcaaccgctagatgtacccagcgctatagttcaacgtcgc
tcgattaaaacttttaaaacagaccccattgccccagaattactcaaacaactagtagac
ttgactgtagccgcacccagtagctttaacattcaagattggcgaattattttagttcaa
gatgaggcgcaaaaagcagccctttctgccgcctcttggaaccaaaaacaaattatcgaa
gcacctgtaacttttgttttcgctgccgattccagcgtcggcgaaggagacttaaccccg
gtttttgaaacagcgttagccactggggcttggaatgaagggactgtgaattattttaaa
aatgctattccccaatttcaagcaggactgggagataagcgccgggaatatgcgattaaa
gatgccattattgctgctacccatttggtattagcagcagaaagtttaggcttatccacc
tgctttatgaacggctggattgaagaccaagtgaaagaagtaattggtgcggcggataat
cctgatttagcgatcgctgttttagttcctgtaggctatgcagcagaaccacgtttaaat
ccaggtcgtctgccattgtctaacaatgtctctgtagacagaattgataatccctatgta
ggttag

DBGET integrated database retrieval system