KEGG   Trichormus variabilis: Ava_4759Help
Entry
Ava_4759          CDS       T00277                                 

Definition
(GenBank) Nitroreductase
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: ABA24356
JGI: Ava4759
CyanoBase: Ava_4759
CYORF: Ava_4759
UniProt: Q3M3T0
Position
complement(5985969..5986634)
Genome map
AA seq 221 aa AA seqDB search
MSTITQIQPLDVPSAIVQRRSIKTFKTDPIAPELLKQLVDLTVAAPSSFNIQDWRIILVQ
DEAQKAALSAASWNQKQIIEAPVTFVFAADSSVGEGDLTPVFETALATGAWNEGTVNYFK
NAIPQFQAGLGDKRREYAIKDAIIAATHLVLAAESLGLSTCFMNGWIEDQVKEVIGAADN
PDLAIAVLVPVGYAAEPRLNPGRLPLSNNVSVDRIDNPYVG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccatcacccaaattcaaccgctagatgtacccagcgctatagttcaacgtcgc
tcgattaaaacttttaaaacagaccccattgccccagaattactcaaacaactagtagac
ttgactgtagccgcacccagtagctttaacattcaagattggcgaattattttagttcaa
gatgaggcgcaaaaagcagccctttctgccgcctcttggaaccaaaaacaaattatcgaa
gcacctgtaacttttgttttcgctgccgattccagcgtcggcgaaggagacttaaccccg
gtttttgaaacagcgttagccactggggcttggaatgaagggactgtgaattattttaaa
aatgctattccccaatttcaagcaggactgggagataagcgccgggaatatgcgattaaa
gatgccattattgctgctacccatttggtattagcagcagaaagtttaggcttatccacc
tgctttatgaacggctggattgaagaccaagtgaaagaagtaattggtgcggcggataat
cctgatttagcgatcgctgttttagttcctgtaggctatgcagcagaaccacgtttaaat
ccaggtcgtctgccattgtctaacaatgtctctgtagacagaattgataatccctatgta
ggttag

DBGET integrated database retrieval system