KEGG   Anabaena variabilis: Ava_4817Help
Entry
Ava_4817          CDS       T00277                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ava  Anabaena variabilis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ava_4817
Enzymes [BR:ava01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Ava_4817
Exosome [BR:ava04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ava_4817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(6055253..6056755)
Genome map
AA seq 500 aa AA seqDB search
MQTSSSGYILALDLGTTGNRAFIFNNAGKIVAQAYKELTQHYPQPGWLEHDAEEIWQDTC
WVMKTAIANAQISPSEIAAIGLTVQRETCLLWDKTTGKPLHKAIVWQDRRTAPLCHQLQE
KGYAQEIYSRTGLVVDAYFSATKLRWLLDYITGVDLKNVLAGTIDTWILWKLTGGKVHAT
DHSNASRTMLMNLKTGEWDEQLLEILQIPAHILPQIQPSLGKFGLTDTSLLDTAIPITAI
LGDQQAALFGHGCDRPGLMKCTYGTGSFLVAHTGSNIVRSQHQLISTIAWTQYNSQENIN
IGYALEGSMFTSGACIQWLRDGIKLIKTAAETETMANQVDDNGGVYFVPAFSGLGAPYWD
MNARGAFFGITASVQPQHLVRAVLEAIAYQVLEVVQAINASCSSPMQRLIVDGGACENNF
LMQFQADVLGIPVERPTMRDTTVQGAAFAAGLAVGFWDSYTALVNQRQIDRIFEPGEGSQ
NAIYNFATWQKAVKRSLDWV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcagacatcatcttccggctatatcctagcgttggacttgggaacaactggaaaccgg
gcatttatctttaacaatgcaggtaaaatagttgctcaagcatataaggaactaacacaa
cattatccccaaccaggatggttagagcatgacgcggaagaaatctggcaagatacctgc
tgggtgatgaaaacagccatcgccaatgcacaaatatctcctagtgaaattgctgctata
ggtttgactgtacaacgggaaacttgcctactgtgggacaaaacgacggggaagccatta
cataaagccattgtttggcaagaccgccgcacggctcccctgtgtcatcagttacaggaa
aaaggctatgctcaggaaatttacagtcgcactggtttagtggttgatgcttatttctca
gcaactaaactccgatggttattagactacatcacaggcgttgatttaaaaaatgttctg
gcaggtacaattgatacctggatactgtggaaattaacaggcggaaaagtccacgccacc
gaccacagcaatgctagccgcaccatgttgatgaatctgaaaactggtgaatgggatgag
caactattagagattttgcaaattcctgcccatattctgccgcaaattcagcccagctta
ggaaaatttggtctgaccgataccagcttgttagatacagctatccccatcacagccatt
ttaggcgatcaacaagcagctttgtttggtcatggctgcgatcgccccggtttaatgaaa
tgtacttatggcactggtagttttttggtggctcacactggctctaatattgttcgttct
caacatcaattaatttctacaatcgcctggacacaatataattcccaggaaaatatcaat
atcggttatgctctagaaggcagtatgtttaccagtggtgcttgtattcaatggttacgt
gatggtatcaaattaattaagacggctgcggaaactgagacaatggcaaatcaagtagat
gataacggtggggtgtactttgtccccgcttttagtggactaggcgcaccctactgggat
atgaacgctagaggagctttttttggcattaccgccagcgtccaaccacagcatttagtc
cgggctgtattagaagcgatcgcctatcaagtgttagaagtagtacaagccatcaatgcc
tcttgtagtagccccatgcagcgcctaattgtcgatggtggtgcttgcgaaaacaatttc
ctcatgcagttccaagcggatgttttaggtattcccgtagaacgtcccaccatgcgcgac
acaacggtacaaggtgcagccttcgccgcaggtttagctgtgggattttgggatagttac
acagcattagttaaccaacgccagatagaccgcatttttgaaccaggagagggaagccaa
aacgccatatacaactttgcgacatggcaaaaggcagttaaacggagtcttgattgggtg
tag

DBGET integrated database retrieval system