KEGG   Anabaena variabilis: Ava_4887Help
Entry
Ava_4887          CDS       T00277                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ava  Anabaena variabilis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ava_4887
Enzymes [BR:ava01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Ava_4887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
6154069..6155022
Genome map
AA seq 317 aa AA seqDB search
MRSYKLIAPAKINLYLEIIGDRPDGYHELVMILQSIDLADEIEIHSLSSETIRVHCNHPQ
VPTDKSNLVYRAAELMATKFPEAFAKYGGVDITVHKHIPVAAGLAGGSTNAAAVLVGIDL
LWNLGLTQTELEELGSILGSDVPFCVAGGTVIATGRGEQLSPLPNLDHIYIVLGKYRSLE
VSTAWAYKTYRQEYGSTYLRDTNDLASRAAAVHSGSIVKAIVEKDAVAIAQKLHNDLEKV
VLPSYPQVLQLRELFASQPSVIGTMMSGSGPSVFALCENQAQAEQVQQQVRQTIPDEDLE
LFVTRTITHGIQVLGNE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcctacaaattaattgctcccgccaaaattaacttgtatctagaaatcatcggc
gacagaccagatgggtatcatgagctagtgatgatattgcaaagtatcgacctagccgac
gagattgaaatacactccctcagcagtgaaaccatccgcgttcattgcaatcacccacaa
gttcccacagacaaaagtaatctcgtatatcgcgccgccgaacttatggcgacaaaattt
cctgaagccttcgctaaatatgggggtgtagatattaccgtccacaaacatattcctgta
gcagctggcttggctggaggttcaaccaacgccgcggctgtgttagtcgggatagattta
ctttggaacttgggactaacccaaacagaactagaagaattgggatctattctgggttcc
gacgtaccattttgtgtcgctggtggtacagtcatcgccaccggtagaggagaacaactt
tcgcccttgcccaatttggatcatatatatatagtattgggcaaatatcgcagcttagaa
gtttccaccgcctgggcatataaaacctatcgtcaagaatatggtagtacttatcttaga
gataccaatgacttagcttcccgcgccgccgcagttcattcaggtagtatagttaaggct
attgtagaaaaagatgccgtagcgatcgcccaaaaactgcacaatgatttagagaaagta
gtattaccttcctatccccaagttttgcaactgagagaattgtttgcatctcaaccaagt
gttatcggaaccatgatgtctggttcaggcccctcagtatttgctttatgtgaaaatcaa
gcacaagcagaacaagttcagcagcaagtaagacaaacaattcccgacgaagatttagaa
ttatttgtaactcgcacgattacacatgggattcaagttttgggtaatgagtaa

DBGET integrated database retrieval system