KEGG   Anabaena variabilis: Ava_4927Help
Entry
Ava_4927          CDS       T00277                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ava  Anabaena variabilis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ava_4927
   00052 Galactose metabolism
    Ava_4927
   00500 Starch and sucrose metabolism
    Ava_4927
   00520 Amino sugar and nucleotide sugar metabolism
    Ava_4927
Enzymes [BR:ava01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Ava_4927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(6195988..6196869)
Genome map
AA seq 293 aa AA seqDB search
MQIHKVRKAVIPAAGFGTRLFPATKVVKKELFPIIDQDGRAKPVILAIVEEAINAGITEI
GIVVQPDDIGVFADLFKNPPAPELLQKLSPHNQEYSQYLQELGQKVVLLTQSEQEGYGHA
VFCAKDWVGNEPFLLMLGDHVYKSDIKKTCAQQVVEIYAQVHQSVVGLTTMPAAIINKAG
CVTGLWQEFNSILELTQLAEKPSIDYAREHLRVEYMAEDEFLCVFGLYVLTPKIFDFLEE
SINQNLRDRGEFQLTTCLDKLCQAEGMTGYVMQGQCFDTGLPNTYRQTLIDFI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattcataaagtaagaaaagccgtgattccggctgctggttttggtactagatta
tttccagctactaaagttgtgaaaaaagaactattcccaattattgatcaagatggtaga
gcaaagcctgtaattttagccattgtggaagaagctattaatgcaggaatcacagaaatt
ggtattgttgtacagcctgatgatataggagtttttgctgatttatttaaaaatccaccc
gcgccagaacttttacagaaactttcgccacacaatcaagaatatagtcaatacttgcaa
gagttgggacagaaagttgttttgttgacacaatcagaacaagaaggttatggccacgca
gtgttttgtgccaaagattgggtagggaatgaaccgtttttattaatgttgggtgatcat
gtttataaatccgacataaaaaaaacttgcgcgcaacaagttgtagagatttacgcacaa
gttcatcaaagtgttgttggcttaactactatgccagcagcgataattaacaaagctgga
tgtgttacaggattgtggcaagagtttaattccattttggaactaacgcaacttgcagaa
aaacccagtattgattatgcgcgtgagcatttgcgggtagaatatatggcagaagatgag
tttttatgtgtttttggtttgtatgtcctcacaccaaaaatctttgattttctagaagaa
agtataaaccaaaatttacgcgatcgcggtgaatttcaattaacaacttgtttagataaa
ttgtgtcaagcagaagggatgacaggatatgtgatgcaagggcaatgttttgatacgggg
ctaccaaatacttatcgccagacattgattgattttatatag

DBGET integrated database retrieval system