KEGG   Anabaena variabilis: Ava_B0029Help
Entry
Ava_B0029         CDS       T00277                                 

Definition
two component LuxR family transcriptional regulator (EC:3.1.1.61)
Orthology
K05971  
[EC:3.1.1.61]
Organism
ava  Anabaena variabilis
Brite
Enzymes [BR:ava01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Ava_B0029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
A:43448..44110
Genome map
AA seq 220 aa AA seqDB search
MIRVVFIEDNDIIRLGITTAINQQPDIEMVGVGHTGNEGVELVKSLSPDVALVDIGLPDI
SGIEVIKQIKKSKSNTKVVVISCNSCQEVITAAISSGADSYILKKNNTSLIVEAIKSTYN
NKSLFDSEIIQRGLLKIFPTQKAKGKIFDDHLTQREISVLALIAAGFSNKQIGEKLFIGE
NTVKNHARNIYSKLGVDSRINAILKGSELGYISNTATQVI
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgattcgagtagtatttattgaggataatgatatcatcaggctcggaataactaccgct
attaatcaacaaccagatatagaaatggtaggggttggtcatacaggaaatgaaggggtg
gaattagttaaaagtttaagccctgatgttgctttagtagacattgggctgcctgatatt
tctggaatcgaggtcattaaacaaatcaagaaatctaaaagcaacactaaagttgttgtc
atttcttgcaactcttgtcaagaggttatcactgctgctatcagtagtggtgctgattct
tatattctcaagaaaaataatacttctttgattgtggaggcaatcaagtccacttacaat
aacaaaagcttattcgattccgaaattattcaaagagggttactcaagattttcccgaca
cagaaagctaaaggcaagatatttgacgaccacttaacccagcgagaaattagtgtttta
gcattaattgctgctggtttttctaataaacaaatcggtgaaaagttgtttattggtgag
aatactgtcaaaaatcatgctaggaatatttactctaaattaggtgttgatagtcggatc
aatgccattctcaaaggctctgaactcggctatatctccaacactgctacccaagttatt
taa

DBGET integrated database retrieval system