KEGG   Anabaena variabilis: Ava_B0029Help
Entry
Ava_B0029         CDS       T00277                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
Organism
ava  Anabaena variabilis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
A:43448..44110
Genome map
AA seq 220 aa AA seqDB search
MIRVVFIEDNDIIRLGITTAINQQPDIEMVGVGHTGNEGVELVKSLSPDVALVDIGLPDI
SGIEVIKQIKKSKSNTKVVVISCNSCQEVITAAISSGADSYILKKNNTSLIVEAIKSTYN
NKSLFDSEIIQRGLLKIFPTQKAKGKIFDDHLTQREISVLALIAAGFSNKQIGEKLFIGE
NTVKNHARNIYSKLGVDSRINAILKGSELGYISNTATQVI
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgattcgagtagtatttattgaggataatgatatcatcaggctcggaataactaccgct
attaatcaacaaccagatatagaaatggtaggggttggtcatacaggaaatgaaggggtg
gaattagttaaaagtttaagccctgatgttgctttagtagacattgggctgcctgatatt
tctggaatcgaggtcattaaacaaatcaagaaatctaaaagcaacactaaagttgttgtc
atttcttgcaactcttgtcaagaggttatcactgctgctatcagtagtggtgctgattct
tatattctcaagaaaaataatacttctttgattgtggaggcaatcaagtccacttacaat
aacaaaagcttattcgattccgaaattattcaaagagggttactcaagattttcccgaca
cagaaagctaaaggcaagatatttgacgaccacttaacccagcgagaaattagtgtttta
gcattaattgctgctggtttttctaataaacaaatcggtgaaaagttgtttattggtgag
aatactgtcaaaaatcatgctaggaatatttactctaaattaggtgttgatagtcggatc
aatgccattctcaaaggctctgaactcggctatatctccaacactgctacccaagttatt
taa

DBGET integrated database retrieval system