KEGG   Anabaena variabilis: Ava_B0145Help
Entry
Ava_B0145         CDS       T00277                                 

Definition
di-haem cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ava  Anabaena variabilis
Brite
Enzymes [BR:ava01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Ava_B0145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
A:complement(159858..161009)
Genome map
AA seq 383 aa AA seqDB search
MKLIRLFTLAVICLLSICLSMGLSKAFGTSPTSEYDWHLPAWMPKPIVPADNPMSSPKVE
LGRHLFYEKRLSITGEFSCASCHIQSLAFTDGKTVAVGATGEKHPRNSMSLANIGYNPVL
TWANPLMTKLETQALVPMFGEHPVEMGMVGREQQILTMLRDDSKYRQMFAAAFGESQEAI
SLSNLTKALAAFERTLISMNSPYDRYRFGGDSHAISKAAQRGEKLFNSERLECFHCHGGI
NFSDSVMHDRLAFVEIAFHNTGLYNIDGKGAYPPDNTGVYEITTQPSDMGRFKAPTLRNI
ALTAPYMHDGSIPTLEAVIDHYKAGGRTIHTGKFAGVGSKNPFKSEFISGFELTEAEKND
LIAFLKSLTDETFIHNPAFSDPN
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaattcgtttgtttaccctcgcagtaatttgtctgttgtcaatttgtctctca
atggggctaagtaaagcatttggcacatcaccgacttcagaatatgactggcatctccca
gcttggatgccgaagccaattgtcccagccgataaccccatgagttcgccaaaagtagag
ttgggacggcatcttttctatgagaagcggttatcaatcacgggtgaattctcttgtgcg
tcttgccatattcagtctttggcttttactgatgggaaaacggtggcggtgggagcaact
ggcgaaaaacacccccgtaactccatgagtctcgctaatattggctacaacccggtatta
acttgggctaaccctttgatgacaaagttggaaactcaagctttagtgccaatgtttggc
gaacatccggtagaaatgggtatggtaggaagggaacaacaaatattaacaatgctgcgg
gatgactccaaatatcgacagatgtttgccgcagcctttggagaaagtcaggaagcaatt
agcttgagtaatctgactaaagctttagcagcatttgaacgtactttgatttctatgaac
tctccctatgatcgttatcgcttcggtggtgactctcatgctatttccaaagctgctcaa
agaggggaaaagttattcaacagcgaacgtctggaatgttttcattgtcatggtggcatt
aattttagcgattcggtgatgcacgatcgcctggcttttgtggaaatcgcctttcacaac
actggcctatataatattgatgggaaaggagcttatccaccagataatactggtgtttat
gaaattactacccaaccctccgatatgggacgtttcaaagctccaactctgcgaaatatt
gctctgactgctccctatatgcacgatggtagtatccctactctagaagcagttatcgac
cactataaagcaggtgggagaacgattcatacaggaaagtttgcaggagtaggaagcaaa
aatcctttcaagagtgaatttattagcggttttgaattaactgaagccgaaaaaaatgac
ctgatagctttcctaaaaagtttaactgatgaaacatttattcataaccctgcttttagt
gatcccaactaa

DBGET integrated database retrieval system